Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.51
PubTator Score 2.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
active ulcerative colitis 3.201 3.0e-02
esophageal adenocarcinoma 2.100 3.2e-02
intraductal papillary-mucinous carcinoma... 1.400 2.4e-02

Gene RIF (4)

AA Sequence

MTCCEGWTSCNGFSLLVLLLLGVVLNAIPLIVSLVEEDQFSQNPISCFEWWFPGIIGAGLMAIPATTMSL      1 - 70
TARKRACCNNRTGMFLSSLFSVITVIGALYCMLISIQALLKGPLMCNSPSNSNANCEFSLKNISDIHPES     71 - 140
FNLQWFFNDSCAPPTGFNKPTSNDTMASGWRASSFHFDSEENKHRLIHFSVFLGLLLVGILEVLFGLSQI    141 - 210
VIGFLGCLCGVSKRRSQIV                                                       211 - 229
//

Text Mined References (11)

PMID Year Title