Property Summary

NCBI Gene PubMed Count 36
Grant Count 1,522
R01 Count 617
Funding $529,222,845.99
PubMed Score 18890.66
PubTator Score 124.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 2.100 0.000

Synonym

Accession Q53HV7 A8K2K9 O95862 Q0D2M0 Q8NB71 Q9BWC8
Symbols FDG
UNG3
HMUDG

Gene

 GO Component (2)

Gene RIF (28)

PMID Text
24253812 Single-strand selective monofunctional uracil-DNA glycosylase (SMUG1) deficiency is linked to aggressive breast cancer and predicts response to adjuvant therapy.
24038406 A case-control study of 801 bladder cancer patients and 801 matched controls, the associations of 167 single nucleotide polymorphisms (SNPs) from 19 genes of the BER pathway with the risk of bladder cancer; 13 SNPs in 10 Base excision repair (BER) pathway genes were significantly associated with bladder cancer risk; most significant SNP was rs2029167 in the SMUG1 gene.
23714858 The results obtained suggest the potential role of the g.4235T>C and the c.-31A>G polymorphisms in AMD pathogenesis.
23253900 There was no difference between SMUG1 proficient and depleted cells following continuous exposure.
23246433 SMUG1 is a DKC1 interaction partner that contributes to rRNA quality control, partly by regulating 5-hydroxymethyluridine levels.
22483865 Data show that uracil-DNA glycosylases SMUG1 and UNG2 display widely different sequence preferences.
21454529 analysis of species specific differences between mouse and humans in regulation of SMUG1 and UNG2
21427733 there was increased risk of breast cancer among postmenopausal women heterozygous for either SMUG1 rs2029166 or rs7296239. Among premenopausal women, the increased risk associated with SMUG1 rs2029166 was limited to those with low folate intake.
20574454 Observational study of gene-disease association. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVT      1 - 70
RYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEVSGAR     71 - 140
FWGFFRNLCGQPEVFFHHCFVHNLCPLLFLAPSGRNLTPAELPAKQREQLLGICDAALCRQVQLLGVRLV    141 - 210
VGVGRLAEQRARRALAGLMPEVQVEGLLHPSPRNPQANKGWEAVAKERLNELGLLPLLLK              211 - 270
//

Text Mined References (36)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
24253812 2013 Single-strand selective monofunctional uracil-DNA glycosylase (SMUG1) deficiency is linked to aggressive breast cancer and predicts response to adjuvant therapy.
24038406 2015 Genetic variations in base excision repair pathway and risk of bladder cancer: a case-control study in the United States.
23714858 2014 Association between polymorphism of the DNA repair SMUG1 and UNG genes and age-related macular degeneration.
23253900 SMUG1 but not UNG DNA glycosylase contributes to the cellular response to recovery from 5-fluorouracil induced replication stress.
23246433 2013 The human base excision repair enzyme SMUG1 directly interacts with DKC1 and contributes to RNA quality control.
22483865 2012 Strikingly different properties of uracil-DNA glycosylases UNG2 and SMUG1 may explain divergent roles in processing of genomic uracil.
21454529 2011 Uracil-DNA glycosylase in base excision repair and adaptive immunity: species differences between man and mouse.
21427733 2011 Single nucleotide polymorphisms in uracil-processing genes, intake of one-carbon nutrients and breast cancer risk.
More...