Property Summary

NCBI Gene PubMed Count 37
PubMed Score 20587.44
PubTator Score 124.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.300 1.1e-03

 GO Component (2)

Gene RIF (27)

AA Sequence

MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVT      1 - 70
RYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEVSGAR     71 - 140
FWGFFRNLCGQPEVFFHHCFVHNLCPLLFLAPSGRNLTPAELPAKQREQLLGICDAALCRQVQLLGVRLV    141 - 210
VGVGRLAEQRARRALAGLMPEVQVEGLLHPSPRNPQANKGWEAVAKERLNELGLLPLLLK              211 - 270
//

Text Mined References (37)

PMID Year Title