Property Summary

NCBI Gene PubMed Count 40
PubMed Score 36.41
PubTator Score 51.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 8.25582855121661E-95
non-small cell lung cancer 2798 9.75162231600792E-28
atypical teratoid/rhabdoid tumor 1095 3.53785531834299E-14
group 3 medulloblastoma 2254 3.41229656359728E-7
lung adenocarcinoma 2714 4.45934595643297E-7
ovarian cancer 8492 1.25184692361687E-6
malignant mesothelioma 3163 1.32822167544505E-6
medulloblastoma, large-cell 6234 1.57390390432813E-6
pediatric high grade glioma 2712 3.03180920264646E-6
invasive ductal carcinoma 2950 8.63188749163055E-5
primitive neuroectodermal tumor 3031 1.68144020069883E-4
inflammatory breast cancer 404 2.02249878803956E-4
breast carcinoma 1614 3.02412924213892E-4
glioblastoma 5572 4.59726266404336E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00244356731830115
adrenocortical carcinoma 1427 0.003606280704926
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0220114719175769

Expression

Synonym

Accession Q53HL2 D3DPT4 Q53HN1 Q96AM3 Q9NVW5
Symbols BOR
DasraB
MESRGP
BOREALIN

Gene

PDB

2KDD   2QFA   2RAW   2RAX  

  Ortholog (9)

Gene RIF (18)

PMID Text
26170459 enhanced CDCA8 promoter activities by NF-Y overexpression and reduced CDCA8 transcription by NF-Y knockdown further verified that NF-Y is a positive regulator of CDCA8 transcription.
25854549 Borealin dimerization mediates chromosomal passenger complex checkpoint function by enhancing localization to centromeres and kinetochores.
25260804 In colorectal cancer patients, Borealin expression was positively correlated with age, lymph node metastasis and neoplasm staging.
24917673 These findings reveal a previously unrecognized but direct link between HP1 and CPC localization in the centromere and illustrate the critical role of borealin-HP1 interaction in orchestrating an accurate cell division.
22797924 MLL5 functionally interacts with Borealin, facilitates the expression of chromosomal passenger complex, and hence contributes to mitotic fidelity and genomic integrity.
22724069 Borealin interacts directly with the Snf7 components of ESCRT-III in human cells.the Borealin central region encompassing residues 110-207 was both necessary & sufficient to bind to CHMP4C.
20803554 important role for phosphorylation of Borealin at S219 in the proper progression through mitosis
19530738 found that substitutions at Borealin T230, recently identified as an Mps1 phosphorylation site, can modulate the dimerization state of Borealin
18946085 Data describe a mitotic SUMO2/3 conjugation-deconjugation cycle of Borealin and further assign a regulatory function of RanBP2 and SENP3 in the mitotic SUMO pathway.
18311593 Borealin plays a crucial role in the early mouse embryonic development
More...

AA Sequence

MAPRKGSSRVAKTNSLRRRKLASFLKDFDREVEIRIKQIESDRQNLLKEVDNLYNIEILRLPKALREMNW      1 - 70
LDYFALGGNKQALEEAATADLDITEINKLTAEAIQTPLKSAKTRKVIQVDEMIVEEEEEEENERKNLQTA     71 - 140
RVKRCPPSKKRTQSIQGKGKGKRSSRANTVTPAVGRLEVSMVKPTPGLTPRFDSRVFKTPGLRTPAAGER    141 - 210
IYNISGNGSPLADSKEIFLTVPVGGGESLRLLASDLQRHSIAQLDPEALGNIKKLSNRLAQICSSIRTHK    211 - 280
//

Text Mined References (48)

PMID Year Title
26170459 2015 Transcriptional activation of human CDCA8 gene regulated by transcription factor NF-Y in embryonic stem cells and cancer cells.
25854549 2015 Borealin dimerization mediates optimal CPC checkpoint function by enhancing localization to centromeres and kinetochores.
25416956 2014 A proteome-scale map of the human interactome network.
25260804 2014 Borealin/Dasra B is overexpressed in colorectal cancers and contributes to proliferation of cancer cells.
24917673 2014 Chromatin protein HP1 interacts with the mitotic regulator borealin protein and specifies the centromere localization of the chromosomal passenger complex.
24571573 2014 The GAR domain of GAS2L3 mediates binding to the chromosomal passenger complex and is required for localization of GAS2L3 to the constriction zone during abscission.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22797924 2012 MLL5 maintains genomic integrity by regulating the stability of the chromosomal passenger complex through a functional interaction with Borealin.
22724069 2012 The chromosomal passenger complex controls the function of endosomal sorting complex required for transport-III Snf7 proteins during cytokinesis.
More...