Property Summary

NCBI Gene PubMed Count 42
PubMed Score 37.62
PubTator Score 51.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma 1.292 3.6e-03
adult high grade glioma 1.500 3.2e-05
atypical teratoid / rhabdoid tumor 1.700 3.2e-09
Breast cancer 1.900 2.0e-12
breast carcinoma 1.400 3.0e-04
glioblastoma 1.700 1.2e-07
group 3 medulloblastoma 2.500 3.4e-07
intraductal papillary-mucinous carcinoma... 1.800 2.2e-02
intraductal papillary-mucinous neoplasm ... 1.800 2.4e-03
invasive ductal carcinoma 1.300 8.6e-05
lung adenocarcinoma 1.500 4.5e-07
malignant mesothelioma 1.300 1.3e-06
medulloblastoma, large-cell 2.700 1.6e-06
non-small cell lung cancer 2.277 9.8e-28
ovarian cancer 1.400 1.3e-06
primitive neuroectodermal tumor 1.600 1.7e-04
psoriasis 1.300 8.3e-95

Gene RIF (19)

AA Sequence

MAPRKGSSRVAKTNSLRRRKLASFLKDFDREVEIRIKQIESDRQNLLKEVDNLYNIEILRLPKALREMNW      1 - 70
LDYFALGGNKQALEEAATADLDITEINKLTAEAIQTPLKSAKTRKVIQVDEMIVEEEEEEENERKNLQTA     71 - 140
RVKRCPPSKKRTQSIQGKGKGKRSSRANTVTPAVGRLEVSMVKPTPGLTPRFDSRVFKTPGLRTPAAGER    141 - 210
IYNISGNGSPLADSKEIFLTVPVGGGESLRLLASDLQRHSIAQLDPEALGNIKKLSNRLAQICSSIRTHK    211 - 280
//

Text Mined References (51)

PMID Year Title