Property Summary

NCBI Gene PubMed Count 10
PubMed Score 11.01
PubTator Score 3.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
acute quadriplegic myopathy 1158 4.4e-07
lung adenocarcinoma 2716 1.1e-06
ovarian cancer 8520 1.8e-05
dermatomyositis 966 5.8e-04

Expression

  Differential Expression (4)

Disease log2 FC p
acute quadriplegic myopathy 1.110 4.4e-07
dermatomyositis 1.200 5.8e-04
lung adenocarcinoma -1.100 1.1e-06
ovarian cancer -1.700 1.8e-05

 GO Function (1)

Gene RIF (3)

AA Sequence

MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSPQRVYRNFHYR      1 - 70
KQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLIDCVGVGLLIATLMWFISNKY     71 - 140
LVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFINHVILTDTFIGYLVGNTLWLVAVGYYIYVTF    141 - 210
LGYSALPFLKNTVILLYPFAPLILLYGLSLALGWNFTHTLCSFYKYRVK                         211 - 259
//

Text Mined References (16)

PMID Year Title