Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.57
PubTator Score 2.54

Knowledge Summary


No data available


  Disease (4)

Disease Target Count Z-score Confidence
Substance-Related Disorders 115 0.0 0.0
Disease Target Count P-value
atypical teratoid / rhabdoid tumor 5112 4.3e-06
ovarian cancer 8520 8.5e-06
invasive ductal carcinoma 2951 8.1e-04
lung cancer 4740 1.7e-03
psoriasis 6694 1.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Endophthalmitis 12 3.563 1.8


  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 4.3e-06
invasive ductal carcinoma 1.100 8.1e-04
lung cancer 1.300 1.7e-03
ovarian cancer 1.200 8.5e-06
psoriasis 1.100 1.9e-03


Accession Q53HC9 D6W4Y1 O43179 Q53S19 Q53SG2
Symbols TSSC1


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

YAVDWSSADPWLFASLSYDGRLVINRVPRALKYHILL                                     351 - 387

Text Mined References (13)

PMID Year Title