Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.73
PubTator Score 0.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -1.600 0.000
astrocytic glioma -1.100 0.006
glioblastoma multiforme -1.100 0.000
oligodendroglioma -1.200 0.000
medulloblastoma, large-cell -1.500 0.005
ovarian cancer 2.100 0.000

Synonym

Accession Q53HC0 B3KNQ0 Q9H697
Symbols

Gene

Gene RIF (1)

PMID Text
19936222 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MTSPHFSSYDEGPLDVSMAATNLENQLHSAQKNLLFLQREHASTLKGLHSEIRRLQQHCTDLTYELTVKS      1 - 70
SEQTGDGTSKSSELKKRCEELEAQLKVKENENAELLKELEQKNAMITVLENTIKEREKKYLEELKAKSHK     71 - 140
LTLLSSELEQRASTIAYLTSQLHAAKKKLMSSSGTSDASPSGSPVLASYKPAPPKDKLPETPRRRMKKSL    141 - 210
SAPLHPEFEEVYRFGAESRKLLLREPVDAMPDPTPFLLARESAEVHLIKERPLVIPPIASDRSGEQHSPA    211 - 280
REKPHKAHVGVAHRIHHATPPQAQPEVKTLAVDQVNGGKVVRKHSGTDRTV                       281 - 331
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22863007 2012 Exome capture reveals ZNF423 and CEP164 mutations, linking renal ciliopathies to DNA damage response signaling.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
19936222 2009 Forty-three loci associated with plasma lipoprotein size, concentration, and cholesterol content in genome-wide analysis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...