Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.58
PubTator Score 0.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non-small cell lung cancer 2890 1.0e-16
lung adenocarcinoma 2716 1.3e-11
Breast cancer 3578 2.9e-11
psoriasis 6694 3.1e-04
invasive ductal carcinoma 2951 4.4e-03
Disease Target Count Z-score Confidence
Cutis Laxa 39 3.846 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 1.100 2.9e-11
invasive ductal carcinoma 1.300 4.4e-03
lung adenocarcinoma 1.500 1.3e-11
non-small cell lung cancer 1.140 1.0e-16
psoriasis 1.500 3.1e-04

Gene RIF (1)

AA Sequence

MAAAEPSPRRVGFVGAGRMAGAIAQGLIRAGKVEAQHILASAPTDRNLCHFQALGCRTTHSNQEVLQSCL      1 - 70
LVIFATKPHVLPAVLAEVAPVVTTEHILVSVAAGVSLSTLEELLPPNTRVLRVLPNLPCVVQEGAIVMAR     71 - 140
GRHVGSSETKLLQHLLEACGRCEEVPEAYVDIHTGLSGSGVAFVCAFSEALAEGAVKMGMPSSLAHRIAA    141 - 210
QTLLGTAKMLLHEGQHPAQLRSDVCTPGGTTIYGLHALEQGGLRAATMSAVEAATCRAKELSRK          211 - 274
//

Text Mined References (15)

PMID Year Title