Tbio | Pyrroline-5-carboxylate reductase 3 |
Enzyme that catalyzes the last step in proline biosynthesis. Proline is synthesized from either glutamate or ornithine; both are converted to pyrroline-5-carboxylate (P5C), and then to proline via pyrroline-5-carboxylate reductases (PYCRs). PYCRL is exclusively linked to the conversion of ornithine to proline.
This gene encodes a protein that belongs to the pyrroline-5-carboxylate reductase family of enzymes. Members of this family catalyze the final step in proline biosynthesis, converting pyrroline-5-carboxylate to proline. Glutamate and ornithine are precursors in the synthesis of proline. The protein encoded by this gene is a cytoplasmic enzyme involved in the biosynthesis of proline from ornithine. [provided by RefSeq, Aug 2016]
This gene encodes a protein that belongs to the pyrroline-5-carboxylate reductase family of enzymes. Members of this family catalyze the final step in proline biosynthesis, converting pyrroline-5-carboxylate to proline. Glutamate and ornithine are precursors in the synthesis of proline. The protein encoded by this gene is a cytoplasmic enzyme involved in the biosynthesis of proline from ornithine. [provided by RefSeq, Aug 2016]
Comments
Disease | Target Count | P-value |
---|---|---|
non-small cell lung cancer | 2798 | 1.01740977195299E-16 |
lung adenocarcinoma | 2714 | 1.33476778110217E-11 |
psoriasis | 6685 | 3.08746392837785E-4 |
invasive ductal carcinoma | 2950 | 0.00436454904098313 |
non-inflammatory breast cancer | 208 | 0.0201345661980984 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Cutis laxa | 28 | 3.85 | 1.9 |
Disease | log2 FC | p |
---|---|---|
psoriasis | 1.500 | 0.000 |
non-small cell lung cancer | 1.140 | 0.000 |
lung adenocarcinoma | 1.500 | 0.000 |
non-inflammatory breast cancer | 1.100 | 0.020 |
invasive ductal carcinoma | 1.300 | 0.004 |
PMID | Text |
---|---|
18854154 | Knockdown of pyrroline-5-carboxylate reductase-like (PYCRL) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1 |
MAAAEPSPRRVGFVGAGRMAGAIAQGLIRAGKVEAQHILASAPTDRNLCHFQALGCRTTHSNQEVLQSCL 1 - 70 LVIFATKPHVLPAVLAEVAPVVTTEHILVSVAAGVSLSTLEELLPPNTRVLRVLPNLPCVVQEGAIVMAR 71 - 140 GRHVGSSETKLLQHLLEACGRCEEVPEAYVDIHTGLSGSGVAFVCAFSEALAEGAVKMGMPSSLAHRIAA 141 - 210 QTLLGTAKMLLHEGQHPAQLRSDVCTPGGTTIYGLHALEQGGLRAATMSAVEAATCRAKELSRK 211 - 274 //
PMID | Year | Title |
---|---|---|
25416956 | 2014 | A proteome-scale map of the human interactome network. |
23585552 | 2013 | Genome-wide association study identifies genetic risk underlying primary rhegmatogenous retinal detachment. |
23024808 | 2012 | Functional specialization in proline biosynthesis of melanoma. |
22814378 | 2012 | N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. |
21269460 | 2011 | Initial characterization of the human central proteome. |
17974005 | 2007 | The full-ORF clone resource of the German cDNA Consortium. |
17207965 | 2007 | hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes. |
16421571 | 2006 | DNA sequence and analysis of human chromosome 8. |
16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. |
15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
More... |