Property Summary

NCBI Gene PubMed Count 12
PubMed Score 22.04
PubTator Score 3.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute myeloid leukemia 1.200 2.5e-03
aldosterone-producing adenoma -1.403 2.8e-02
Atopic dermatitis 1.200 1.0e-04
Breast cancer 2.400 3.4e-02
group 3 medulloblastoma 1.800 2.4e-02
osteosarcoma 2.565 2.8e-06
ovarian cancer 1.500 4.9e-05
pancreatic cancer 1.500 1.7e-03
pancreatic ductal adenocarcinoma liver m... -1.082 4.7e-02
Polycystic ovary syndrome -1.216 1.6e-03
Rheumatoid arthritis 1.100 1.1e-02
ulcerative colitis 1.100 7.7e-07

Gene RIF (2)

AA Sequence

MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPTSAAASPLSAAAATAASFSAAAASPQKYLRMEPSPFG      1 - 70
DVSSRLTTEQILYNIKQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQ     71 - 140
PLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS           141 - 203
//

Text Mined References (16)

PMID Year Title