Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.79
PubTator Score 2.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 7.5e-05
lung cancer 4740 3.1e-03
osteosarcoma 7950 3.2e-03
invasive ductal carcinoma 2951 1.0e-02

Expression

  Differential Expression (4)

Disease log2 FC p
invasive ductal carcinoma 1.300 1.0e-02
lung cancer 1.200 3.1e-03
osteosarcoma -1.219 3.2e-03
ovarian cancer 1.200 7.5e-05

 GO Process (1)

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MRENVVVSNMERESGKPVAVVAVVTEPWFTQRYREYLQRQKLFDTQHRVEKMPDGSVALPVLGETLPEQH      1 - 70
LQELRNRVAPGSPCMLTQLPDPVPSKRAQGCSPAQKLCLEVSRWVEGRGVKWSAELEADLPRSWQRHGNL     71 - 140
LLLSEDCFQAKQWKNLGPELWETVALALGVQRLAKRGRVSPDGTRTPAVTLLLGDHGWVEHVDNGIRYKF    141 - 210
DVTQCMFSFGNITEKLRVASLSCAGEVLVDLYAGIGYFTLPFLVHAGAAFVHACEWNPHAVVALRNNLEI    211 - 280
NGVADRCQIHFGDNRKLKLSNIADRVILGLIPSSEEGWPIACQVLRQDAGGILHIHQNVESFPGKNLQAL    281 - 350
GVSKVEKEHWLYPQQITTNQWKNGATRDSRGKMLSPATKPEWQRWAESAETRIATLLQQVHGKPWKTQIL    351 - 420
HIQPVKSYAPHVDHIVLDLECCPCPSVG                                              421 - 448
//

Text Mined References (10)

PMID Year Title