Property Summary

NCBI Gene PubMed Count 34
Grant Count 50
R01 Count 39
Funding $4,558,989.06
PubMed Score 25.83
PubTator Score 46.43

Knowledge Summary

Patent

No data available

Expression

Gene RIF (21)

PMID Text
26437079 The SET domain is needed for the 5' end of ss-overhang cleavage with fork and non-fork DNA without affecting the Metnase-DNA interaction. This domain has a positive role in restart of replication fork and the 5' end of ss-overhang cleavage.
25795785 methylation of snRNP70 by SETMAR regulates constitutive and/or alternative splicing
25333365 Metnase may possess an important role in DNA repair, topoisomerase II function, and the maintenance of stemness during colon cancer development.
24655462 293 T transfected with Metnase revealed a large number of rescued plasmids.
24607956 found known and novel SETMAR splice variants to be significantly increased in acute myeloid leukemia
24573677 a single mutation DDN(610) --> DDD(610), which restores the ancestral catalytic site, results in loss of function in Metnase
22231448 phosphorylation of Metnase S495 differentiates between these two functions, enhancing DSB repair and repressing replication fork restart.
21491884 a role for Metnase's endonuclease activity in promoting the joining of noncompatible ends
21187428 DNA repair protein Metnase (also SETMAR), which has a SET histone methylase domain, localized to an induced DSB and directly mediated the formation of H3K36me2 near the induced DSB
21124928 Data show that DBN1, SETMAR and HIG2 are direct transcriptional targets of the SOX11 protein.
More...

AA Sequence

MFAEAAKTTRPCGMAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQI      1 - 70
TFPGCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVVQKGLQFH     71 - 140
FQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYIIAIREHVYNGQVMETFV    141 - 210
DPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVSEDKERLDH    211 - 280
GKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQ    281 - 350
IRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAI    351 - 420
IEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLD    421 - 490
RIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYA    491 - 560
QEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHL    561 - 630
NNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD                    631 - 684
//

Text Mined References (40)

PMID Year Title
26437079 2015 The SET Domain Is Essential for Metnase Functions in Replication Restart and the 5' End of SS-Overhang Cleavage.
25795785 2015 A Proteomic Strategy Identifies Lysine Methylation of Splicing Factor snRNP70 by the SETMAR Enzyme.
25333365 2014 Potential role for the Metnase transposase fusion gene in colon cancer through the regulation of key genes.
24655462 2014 Fidelity of end joining in mammalian episomes and the impact of Metnase on joint processing.
24607956 2014 Delineation of known and new transcript variants of the SETMAR (Metnase) gene and the expression profile in hematologic neoplasms.
24573677 2014 The DDN catalytic motif is required for Metnase functions in non-homologous end joining (NHEJ) repair and replication restart.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22231448 2012 Chk1 phosphorylation of Metnase enhances DNA repair but inhibits replication fork restart.
21491884 2011 Biochemical characterization of metnase's endonuclease activity and its role in NHEJ repair.
More...