Property Summary

NCBI Gene PubMed Count 35
PubMed Score 26.49
PubTator Score 46.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.200 2.2e-03
atypical teratoid / rhabdoid tumor 1.100 5.5e-04
group 3 medulloblastoma 1.200 6.9e-04
inflammatory breast cancer -1.100 1.2e-05
intraductal papillary-mucinous neoplasm ... -1.300 1.8e-03
malignant mesothelioma 1.300 3.1e-06
medulloblastoma, large-cell 1.600 6.0e-06
osteosarcoma 2.019 1.2e-06
ovarian cancer 1.400 1.1e-09
posterior fossa group B ependymoma 1.200 1.5e-05
psoriasis -1.100 1.1e-03

Protein-protein Interaction (4)

Gene RIF (22)

AA Sequence

MFAEAAKTTRPCGMAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQI      1 - 70
TFPGCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVVQKGLQFH     71 - 140
FQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYIIAIREHVYNGQVMETFV    141 - 210
DPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIVPEEELSYDYSGRYLNLTVSEDKERLDH    211 - 280
GKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTLETMKMMLDKKQ    281 - 350
IRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAI    351 - 420
IEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNEPFLD    421 - 490
RIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYA    491 - 560
QEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHL    561 - 630
NNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD                    631 - 684
//

Text Mined References (41)

PMID Year Title