Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.11
PubTator Score 2.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3232 1.7e-06
psoriasis 6694 1.1e-03
medulloblastoma, large-cell 6241 5.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Hepatoblastoma 19 3.457 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.300 1.7e-06
medulloblastoma, large-cell -1.400 5.5e-03
psoriasis -1.200 1.1e-03

Gene RIF (1)

AA Sequence

MAEEQEFTQLCKLPAQPSHPHCVNNTYRSAQHSQALLRGLLALRDSGILFDVVLVVEGRHIEAHRILLAA      1 - 70
SCDYFRGMFAGGLKEMEQEEVLIHGVSYNAMCQILHFIYTSELELSLSNVQETLVAACQLQIPEIIHFCC     71 - 140
DFLMSWVDEENILDVYRLAELFDLSRLTEQLDTYILKNFVAFSRTDKYRQLPLEKVYSLLSSNRLEVSCE    141 - 210
TEVYEGALLYHYSLEQVQADQISLHEPPKLLETVRFPLMEAEVLQRLHDKLDPSPLRDTVASALMYHRNE    211 - 280
SLQPSLQSPQTELRSDFQCVVGFGGIHSTPSTVLSDQAKYLNPLLGEWKHFTASLAPRMSNQGIAVLNNF    281 - 350
VYLIGGDNNVQGFRAESRCWRYDPRHNRWFQIQSLQQEHADLSVCVVGRYIYAVAGRDYHNDLNAVERYD    351 - 420
PATNSWAYVAPLKREVYAHAGATLEGKMYITCGRRGEDYLKETHCYDPGSNTWHTLADGPVRRAWHGMAT    421 - 490
LLNKLYVIGGSNNDAGYRRDVHQVACYSCTSGQWSSVCPLPAGHGEPGIAVLDNRIYVLGGRSHNRGSRT    491 - 560
GYVHIYDVEKDCWEEGPQLDNSISGLAACVLTLPRSLLLEPPRGTPDRSQADPDFASEVMSVSDWEEFDN    561 - 630
SSED                                                                      631 - 634
//

Text Mined References (15)

PMID Year Title