Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.11
PubTator Score 2.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 1.71659641758138E-6
psoriasis 6685 0.00106922329936511
medulloblastoma, large-cell 6234 0.00547466591859805
Disease Target Count Z-score Confidence
Hepatoblastoma 17 3.453 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
psoriasis -1.200 0.001
medulloblastoma, large-cell -1.400 0.005

Synonym

Accession Q53GT1 A8K3Q4 A8MTV3 B7Z2G1 D3DX30 Q96B68 Q96KC6
Symbols KELCHL

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
24067371 CUL3/KLHL22 may contact two distinct motifs within PLK1 protein, consistent with the bivalent mode of substrate targeting.

AA Sequence

MAEEQEFTQLCKLPAQPSHPHCVNNTYRSAQHSQALLRGLLALRDSGILFDVVLVVEGRHIEAHRILLAA      1 - 70
SCDYFRGMFAGGLKEMEQEEVLIHGVSYNAMCQILHFIYTSELELSLSNVQETLVAACQLQIPEIIHFCC     71 - 140
DFLMSWVDEENILDVYRLAELFDLSRLTEQLDTYILKNFVAFSRTDKYRQLPLEKVYSLLSSNRLEVSCE    141 - 210
TEVYEGALLYHYSLEQVQADQISLHEPPKLLETVRFPLMEAEVLQRLHDKLDPSPLRDTVASALMYHRNE    211 - 280
SLQPSLQSPQTELRSDFQCVVGFGGIHSTPSTVLSDQAKYLNPLLGEWKHFTASLAPRMSNQGIAVLNNF    281 - 350
VYLIGGDNNVQGFRAESRCWRYDPRHNRWFQIQSLQQEHADLSVCVVGRYIYAVAGRDYHNDLNAVERYD    351 - 420
PATNSWAYVAPLKREVYAHAGATLEGKMYITCGRRGEDYLKETHCYDPGSNTWHTLADGPVRRAWHGMAT    421 - 490
LLNKLYVIGGSNNDAGYRRDVHQVACYSCTSGQWSSVCPLPAGHGEPGIAVLDNRIYVLGGRSHNRGSRT    491 - 560
GYVHIYDVEKDCWEEGPQLDNSISGLAACVLTLPRSLLLEPPRGTPDRSQADPDFASEVMSVSDWEEFDN    561 - 630
SSED                                                                      631 - 634
//

Text Mined References (14)

PMID Year Title
24067371 2013 CUL3 and protein kinases: insights from PLK1/KLHL22 interaction.
23676014 2013 Update on the Kelch-like (KLHL) gene family.
23455478 2013 Ubiquitylation-dependent localization of PLK1 in mitosis.
23393555 2013 Genome-wide association study of retinopathy in individuals without diabetes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
19995937 2009 The Cul3-KLHL21 E3 ubiquitin ligase targets aurora B to midzone microtubules in anaphase and is required for cytokinesis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
More...