Property Summary

NCBI Gene PubMed Count 17
Grant Count 14
Funding $499,787
PubMed Score 135.78
PubTator Score 18.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.800 0.000
osteosarcoma -1.002 0.000

Gene RIF (7)

PMID Text
26081192 Our data indicate that USP39 knockdown inhibited the growth of HCC both in vitro and in vivo through G2/M arrest, which was partly achieved via the inhibition of FoxM1 splicing.
25812575 Inducible knockdown of USP39 or overexpression of USP39 in TNBC cells.
24126978 These results suggest that USP39 may act as an oncogenic factor in breast cancer and could be a potential molecular target for breast cancer gene therapy.
22174317 HIV-1 Rev interacting protein, ubiquitin specific peptidase 39 (USP39), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with USP39 is increased by RRE
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18976975 Knockdown of ubiquitin specific peptidase 39 (USP39) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18728397 These observations suggest Usp39 to be involved in splicing of Aurora B and other mRNAs that are essential for proper spindle checkpoint function.

AA Sequence

MSGRSKRESRGSTRGKRESESRGSSGRVKRERDREREPEAASSRGSPVRVKREFEPASAREAPASVVPFV      1 - 70
RVKREREVDEDSEPEREVRAKNGRVDSEDRRSRHCPYLDTINRSVLDFDFEKLCSISLSHINAYACLVCG     71 - 140
KYFQGRGLKSHAYIHSVQFSHHVFLNLHTLKFYCLPDNYEIIDSSLEDITYVLKPTFTKQQIANLDKQAK    141 - 210
LSRAYDGTTYLPGIVGLNNIKANDYANAVLQALSNVPPLRNYFLEEDNYKNIKRPPGDIMFLLVQRFGEL    211 - 280
MRKLWNPRNFKAHVSPHEMLQAVVLCSKKTFQITKQGDGVDFLSWFLNALHSALGGTKKKKKTIVTDVFQ    281 - 350
GSMRIFTKKLPHPDLPAEEKEQLLHNDEYQETMVESTFMYLTLDLPTAPLYKDEKEQLIIPQVPLFNILA    351 - 420
KFNGITEKEYKTYKENFLKRFQLTKLPPYLIFCIKRFTKNNFFVEKNPTIVNFPITNVDLREYLSEEVQA    421 - 490
VHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDET    491 - 560
NQQGA                                                                     561 - 565
//

Text Mined References (25)

PMID Year Title
26081192 2015 USP39 promotes the growth of human hepatocellular carcinoma in vitro and in vivo.
25812575 2015 Lentiviral vector-mediated doxycycline-inducible USP39 shRNA or cDNA expression in triple-negative breast cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24126978 2013 Lentivirus-mediated inhibition of USP39 suppresses the growth of breast cancer cells in vitro.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
More...