Property Summary

NCBI Gene PubMed Count 26
PubMed Score 36.66
PubTator Score 18.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3232 2.9e-07
ovarian cancer 8520 1.0e-05
cystic fibrosis 1696 3.9e-04
Multiple myeloma 1332 1.0e-02
active Crohn's disease 922 1.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Neuroblastoma 80 0.0 3.0
substance-related disorder 162 0.0 1.1

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease 1.275 1.9e-02
cystic fibrosis -1.200 3.9e-04
malignant mesothelioma -1.600 2.9e-07
Multiple myeloma 1.174 1.0e-02
ovarian cancer -1.700 1.0e-05

Gene RIF (12)

AA Sequence

MESALPAAGFLYWVGAGTVAYLALRISYSLFTALRVWGVGNEAGVGPGLGEWAVVTGSTDGIGKSYAEEL      1 - 70
AKHGMKVVLISRSKDKLDQVSSEIKEKFKVETRTIAVDFASEDIYDKIKTGLAGLEIGILVNNVGMSYEY     71 - 140
PEYFLDVPDLDNVIKKMININILSVCKMTQLVLPGMVERSKGAILNISSGSGMLPVPLLTIYSATKTFVD    141 - 210
FFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNGYLIHALMGS    211 - 280
IISNLPSWIYLKIVMNMNKSTRAHYLKKTKKN                                          281 - 312
//

Text Mined References (30)

PMID Year Title