Property Summary

NCBI Gene PubMed Count 16
PubMed Score 14.06
PubTator Score 12.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Synonym

Accession Q53GL7 Q8N2I0 Q8WV05 Q96CH7 Q96K72 PARP-10
Symbols ARTD10

Gene

PANTHER Protein Class (1)

PDB

2DHX   3HKV  

Gene RIF (6)

PMID Text
24878761 ARTD10 plays roles in immunity, metabolism ,apoptosis and DNA damage repair. [review]
24695737 PARP10 binding to PCNA is required for translesion DNA synthesis.
22176891 study results show that the interaction between PARP10 and NS1 of H5N1 avian influenza virus can change cell cycle, and PARP10 can affect virus replication
18851833 alternative catalytic mechanism for PARP10 compared to PARP1 in which the acidic target residue of the substrate functionally substitutes for the catalytic glutamate by using substrate-assisted catalysis to transfer ADP-ribose
16455663 Overexpression of PARP10 results in loss of cell viability, although down-expression by short hairpin RNA leads to delayed G1 progression and concomitant cell death.
15674325 novel PARP enzyme involved in the control of cell proliferation

AA Sequence

MVAMAEAEAGVAVEVRGLPPAVPDELLTLYFENRRRSGGGPVLSWQRLGCGGVLTFREPADAERVLAQAD      1 - 70
HELHGAQLSLRPAPPRAPARLLLQGLPPGTTPQRLEQHVQALLRASGLPVQPCCALASPRPDRALVQLPK     71 - 140
PLSEADVRVLEEQAQNLGLEGTLVSLARVPQARAVRVVGDGASVDLLLLELYLENERRSGGGPLEDLQRL    141 - 210
PGPLGTVASFQQWQVAERVLQQEHRLQGSELSLVPHYDILEPEELAENTSGGDHPSTQGPRATKHALLRT    211 - 280
GGLVTALQGAGTVTMGSGEEPGQSGASLRTGPMVQGRGIMTTGSGQEPGQSGTSLRTGPMGSLGQAEQVS    281 - 350
SMPMGSLEHEGLVSLRPVGLQEQEGPMSLGPVGSAGPVETSKGLLGQEGLVEIAMDSPEQEGLVGPMEIT    351 - 420
MGSLEKAGPVSPGCVKLAGQEGLVEMVLLMEPGAMRFLQLYHEDLLAGLGDVALLPLEGPDMTGFRLCGA    421 - 490
QASCQAAEEFLRSLLGSISCHVLCLEHPGSARFLLGPEGQHLLQGLEAQFQCVFGTERLATATLDTGLEE    491 - 560
VDPTEALPVLPGNAHTLWTPDSTGGDQEDVSLEEVRELLATLEGLDLDGEDWLPRELEEEGPQEQPEEEV    561 - 630
TPGHEEEEPVAPSTVAPRWLEEEAALQLALHRSLEPQGQVAEQEEAAALRQALTLSLLEQPPLEAEEPPD    631 - 700
GGTDGKAQLVVHSAFEQDVEELDRALRAALEVHVQEETVGPWRRTLPAELRARLERCHGVSVALRGDCTI    701 - 770
LRGFGAHPARAARHLVALLAGPWDQSLAFPLAASGPTLAGQTLKGPWNNLERLAENTGEFQEVVRAFYDT    771 - 840
LDAARSSIRVVRVERVSHPLLQQQYELYRERLLQRCERRPVEQVLYHGTTAPAVPDICAHGFNRSFCGRN    841 - 910
ATVYGKGVYFARRASLSVQDRYSPPNADGHKAVFVARVLTGDYGQGRRGLRAPPLRGPGHVLLRYDSAVD    911 - 980
CICQPSIFVIFHDTQALPTHLITCEHVPRASPDDPSGLPGRSPDT                             981 - 1025
//

Text Mined References (20)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24878761 2015 Function and regulation of the mono-ADP-ribosyltransferase ARTD10.
24695737 2014 The ADP-ribosyltransferase PARP10/ARTD10 interacts with proliferating cell nuclear antigen (PCNA) and is required for DNA damage tolerance.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23575687 2013 Regulation of NF-?B signalling by the mono-ADP-ribosyltransferase ARTD10.
23481255 2013 Deficiency of terminal ADP-ribose protein glycohydrolase TARG1/C6orf130 in neurodegenerative disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22176891 2011 The interaction between the PARP10 protein and the NS1 protein of H5N1 AIV and its effect on virus replication.
20106667 2010 Toward a unified nomenclature for mammalian ADP-ribosyltransferases.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...