Property Summary

NCBI Gene PubMed Count 26
Grant Count 2
R01 Count 2
Funding $57,760
PubMed Score 60.71
PubTator Score 25.72

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

PMID Text
26160174 There is a major role of the CK2alpha-interacting protein CKIP-1 in activation of PAK1 for neoplastic prostate cells transformation.
24465689 CKIP-1 interacts with CARMA1 and has an inhibitory effect on PKCtheta;-CBM-NF-kappaB signaling.
23995790 CKIP-1 controlled Smurf1 expression in colon cancer
23583459 overexpression triggers classical monocyte activation and transactivation of the TNF promoter
23032291 CKIP-1, through its leucine zipper, interacts with the Rpt6 and mediates the Smurf1-Rpt6 interaction.
22878216 CKIP-1 is involved in various important signaling pathways, controlling cell growth, apoptosis, differentiation, cytoskeleton and bone formation--REVIEW
20171213 The N-terminal PH domain and C-terminal auto-inhibitory region of CKIP-1 coordinate to determine its subcellular localization and the nucleus-plasma membrane shuttling.
17942896 Results indicate that CKIP-1, a novel Akt PH domain-interacting protein, would be a candidate of tumor suppressor with an Akt inhibitory function.
17197158 The results provide a novel role of CKIP-1 in cytokine signaling response and the biochemical mechanism, by which two previously identified modulators IFP35 and Nmi are involved via interactions.
16987810 CKIP-1 has a role in cell morphology that depends on its interaction with actin-capping protein
More...

AA Sequence

MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKGDQLYISEKEVKDEKNIQEVF      1 - 70
DLSDYEKCEELRKSKSRSKKNHSKFTLAHSKQPGNTAPNLIFLAVSPEEKESWINALNSAITRAKNRILD     71 - 140
EVTVEEDSYLAHPTRDRAKIQHSRRPPTRGHLMAVASTSTSDGMLTLDLIQEEDPSPEEPTSCAESFRVD    141 - 210
LDKSVAQLAGSRRRADSDRIQPSADRASSLSRPWEKTDKGATYTPQAPKKLTPTEKGRCASLEEILSQRD    211 - 280
AASARTLQLRAEEPPTPALPNPGQLSRIQDLVARKLEETQELLAEVQGLGDGKRKAKDPPRSPPDSESEQ    281 - 350
LLLETERLLGEASSNWSQAKRVLQEVRELRDLYRQMDLQTPDSHLRQTTPHSQYRKSLM               351 - 409
//

Text Mined References (31)

PMID Year Title
26160174 2015 The Role of the Pleckstrin Homology Domain-containing Protein CKIP-1 in Activation of p21-activated Kinase 1 (PAK1).
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24465689 2014 CKIP-1 is an intrinsic negative regulator of T-cell activation through an interaction with CARMA1.
23995790 2014 CKIP-1 acts as a colonic tumor suppressor by repressing oncogenic Smurf1 synthesis and promoting Smurf1 autodegradation.
23583459 2013 Casein kinase 2-interacting protein-1, an inflammatory signaling molecule interferes with TNF reverse signaling in human model cells.
23032291 2012 CKIP-1 couples Smurf1 ubiquitin ligase with Rpt6 subunit of proteasome to promote substrate degradation.
22878216 2013 CKIP-1: a scaffold protein and potential therapeutic target integrating multiple signaling pathways and physiological functions.
21382345 2011 Smurf1 ubiquitin ligase targets Kruppel-like factor KLF2 for ubiquitination and degradation in human lung cancer H1299 cells.
20580715 2010 REGgamma proteasome mediates degradation of the ubiquitin ligase Smurf1.
20171213 2010 N-terminal PH domain and C-terminal auto-inhibitory region of CKIP-1 coordinate to determine its nucleus-plasma membrane shuttling.
More...