Property Summary

NCBI Gene PubMed Count 30
PubMed Score 66.56
PubTator Score 25.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

 MGI Phenotype (1)

Gene RIF (19)

AA Sequence

MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKGDQLYISEKEVKDEKNIQEVF      1 - 70
DLSDYEKCEELRKSKSRSKKNHSKFTLAHSKQPGNTAPNLIFLAVSPEEKESWINALNSAITRAKNRILD     71 - 140
EVTVEEDSYLAHPTRDRAKIQHSRRPPTRGHLMAVASTSTSDGMLTLDLIQEEDPSPEEPTSCAESFRVD    141 - 210
LDKSVAQLAGSRRRADSDRIQPSADRASSLSRPWEKTDKGATYTPQAPKKLTPTEKGRCASLEEILSQRD    211 - 280
AASARTLQLRAEEPPTPALPNPGQLSRIQDLVARKLEETQELLAEVQGLGDGKRKAKDPPRSPPDSESEQ    281 - 350
LLLETERLLGEASSNWSQAKRVLQEVRELRDLYRQMDLQTPDSHLRQTTPHSQYRKSLM               351 - 409
//

Text Mined References (35)

PMID Year Title