Property Summary

NCBI Gene PubMed Count 26
Grant Count 7
R01 Count 5
Funding $684,919.28
PubMed Score 37.97
PubTator Score 16.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Barrett's esophagus 2.600 0.040
esophageal adenocarcinoma 3.300 0.018
medulloblastoma, large-cell 1.100 0.000
colon cancer -1.700 0.016
pancreatic cancer 2.400 0.000
interstitial cystitis -1.600 0.012
nasopharyngeal carcinoma -2.100 0.000
lung adenocarcinoma 1.409 0.002
breast carcinoma 1.900 0.000
Breast cancer 1.600 0.000
ductal carcinoma in situ 3.000 0.004
invasive ductal carcinoma 3.800 0.000
ovarian cancer 2.000 0.000

Gene RIF (9)

PMID Text
26901654 epigenetic mechanisms (histone modifications) play a role in determining the tissue-specific pattern of expression of the TPPT along the GI tract.
26828122 The results also provide an indirect support for a membrane topology for hTPPT with 10 transmembrane domains as predicted by the TMHMM transmembrane helixes prediction program.
25715703 Characterization of the SLC44A4 promoter and report the importance of both ELF3 and CREB-1 transcription factors in the maintenance of basal promoter activity in colonic epithelial cells.
24379411 Molecular identification and functional characterization of the human colonic thiamine pyrophosphate transporter.
23651124 These results indicate that CTL4 mediates ACh synthesis in non-neuronal cell lines and presents a mechanism to target non-neuronal ACh synthesis without affecting neuronal ACh synthesis.
22789125 These results suggest that eltrombopag can partially modulate some immune responses by TGFbeta(1) and sCTLA-4, but it does not induce immune tolerance by 24 weeks after treatment.
20526339 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20466734 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGGKQRDEDDEAYGKPVKYDPSFRGPIKNRSCTDVICCVLFLLFILGYIVVGIVAWLYGDPRQVLYPRNS      1 - 70
TGAYCGMGENKDKPYLLYFNIFSCILSSNIISVAENGLQCPTPQVCVSSCPEDPWTVGKNEFSQTVGEVF     71 - 140
YTKNRNFCLPGVPWNMTVITSLQQELCPSFLLPSAPALGRCFPWTNVTPPALPGITNDTTIQQGISGLID    141 - 210
SLNARDISVKIFEDFAQSWYWILVALGVALVLSLLFILLLRLVAGPLVLVLILGVLGVLAYGIYYCWEEY    211 - 280
RVLRDKGASISQLGFTTNLSAYQSVQETWLAALIVLAVLEAILLLMLIFLRQRIRIAIALLKEASKAVGQ    281 - 350
MMSTMFYPLVTFVLLLICIAYWAMTALYLATSGQPQYVLWASNISSPGCEKVPINTSCNPTAHLVNSSCP    351 - 420
GLMCVFQGYSSKGLIQRSVFNLQIYGVLGLFWTLNWVLALGQCVLAGAFASFYWAFHKPQDIPTFPLISA    421 - 490
FIRTLRYHTGSLAFGALILTLVQIARVILEYIDHKLRGVQNPVARCIMCCFKCCLWCLEKFIKFLNRNAY    491 - 560
IMIAIYGKNFCVSAKNAFMLLMRNIVRVVVLDKVTDLLLFFGKLLVVGGVGVLSFFFFSGRIPGLGKDFK    561 - 630
SPHLNYYWLPIMTSILGAYVIASGFFSVFGMCVDTLFLCFLEDLERNNGSLDRPYYMSKSLLKILGKKNE    631 - 700
APPDNKKRKK                                                                701 - 710
//

Text Mined References (28)

PMID Year Title
26901654 2016 Mechanism(S) Involved in the Colon-Specific Expression of the Thiamine Pyrophosphate (Tpp) Transporter.
26828122 2016 The human colonic thiamine pyrophosphate transporter (hTPPT) is a glycoprotein and N-linked glycosylation is important for its function.
25715703 2015 Regulation of basal promoter activity of the human thiamine pyrophosphate transporter SLC44A4 in human intestinal epithelial cells.
24837172 2015 Genome-wide association scan in north Indians reveals three novel HLA-independent risk loci for ulcerative colitis.
24379411 2014 Molecular identification and functional characterization of the human colonic thiamine pyrophosphate transporter.
23651124 2013 Choline transporter-like protein 4 (CTL4) links to non-neuronal acetylcholine synthesis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22789125 2012 TGF?(1) and sCTLA-4 levels are increased in eltrombopag-exposed patients with ITP.
20526339 2010 Genome-wide association study for vitiligo identifies susceptibility loci at 6q27 and the MHC.
More...