Property Summary

NCBI Gene PubMed Count 30
PubMed Score 44.09
PubTator Score 16.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Barrett's esophagus 2.600 4.0e-02
Breast cancer 1.600 2.6e-04
breast carcinoma 1.500 5.9e-19
colon cancer -1.700 1.6e-02
ductal carcinoma in situ 3.000 4.2e-03
esophageal adenocarcinoma 3.300 1.8e-02
interstitial cystitis -1.200 1.3e-02
invasive ductal carcinoma 1.800 1.0e-03
lung adenocarcinoma 1.409 2.4e-03
medulloblastoma, large-cell 1.100 2.8e-04
nasopharyngeal carcinoma -2.100 4.6e-09
ovarian cancer 2.000 5.8e-08
pancreatic cancer 1.600 5.8e-05

Gene RIF (13)

AA Sequence

MGGKQRDEDDEAYGKPVKYDPSFRGPIKNRSCTDVICCVLFLLFILGYIVVGIVAWLYGDPRQVLYPRNS      1 - 70
TGAYCGMGENKDKPYLLYFNIFSCILSSNIISVAENGLQCPTPQVCVSSCPEDPWTVGKNEFSQTVGEVF     71 - 140
YTKNRNFCLPGVPWNMTVITSLQQELCPSFLLPSAPALGRCFPWTNVTPPALPGITNDTTIQQGISGLID    141 - 210
SLNARDISVKIFEDFAQSWYWILVALGVALVLSLLFILLLRLVAGPLVLVLILGVLGVLAYGIYYCWEEY    211 - 280
RVLRDKGASISQLGFTTNLSAYQSVQETWLAALIVLAVLEAILLLMLIFLRQRIRIAIALLKEASKAVGQ    281 - 350
MMSTMFYPLVTFVLLLICIAYWAMTALYLATSGQPQYVLWASNISSPGCEKVPINTSCNPTAHLVNSSCP    351 - 420
GLMCVFQGYSSKGLIQRSVFNLQIYGVLGLFWTLNWVLALGQCVLAGAFASFYWAFHKPQDIPTFPLISA    421 - 490
FIRTLRYHTGSLAFGALILTLVQIARVILEYIDHKLRGVQNPVARCIMCCFKCCLWCLEKFIKFLNRNAY    491 - 560
IMIAIYGKNFCVSAKNAFMLLMRNIVRVVVLDKVTDLLLFFGKLLVVGGVGVLSFFFFSGRIPGLGKDFK    561 - 630
SPHLNYYWLPIMTSILGAYVIASGFFSVFGMCVDTLFLCFLEDLERNNGSLDRPYYMSKSLLKILGKKNE    631 - 700
APPDNKKRKK                                                                701 - 710
//

Text Mined References (32)

PMID Year Title