Property Summary

NCBI Gene PubMed Count 35
Grant Count 7
R01 Count 1
Funding $84,961.3
PubMed Score 55.82
PubTator Score 65.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
osteosarcoma 2.441 0.002
Rheumatoid Arthritis 1.200 0.050
nephrosclerosis 1.287 0.002
gastric carcinoma 2.800 0.035
hepatocellular carcinoma -1.800 0.001
astrocytic glioma -1.500 0.019
ependymoma -1.500 0.039
oligodendroglioma -1.700 0.013
psoriasis 3.300 0.000
glioblastoma 1.200 0.041
medulloblastoma, large-cell -1.400 0.018
tuberculosis -1.600 0.048
pancreatic ductal adenocarcinoma liver m... 2.202 0.013
intraductal papillary-mucinous neoplasm ... 2.600 0.015
lung cancer 1.300 0.001
pancreatic cancer 2.800 0.000
breast carcinoma 1.600 0.001
pediatric high grade glioma 1.900 0.013
group 4 medulloblastoma -2.000 0.002
non primary Sjogren syndrome sicca -1.100 0.022
lung adenocarcinoma 2.381 0.000
Breast cancer 1.100 0.033
spina bifida -1.568 0.045
ductal carcinoma in situ 2.500 0.000
ulcerative colitis 1.800 0.000
ovarian cancer 3.900 0.000
pituitary cancer -1.900 0.000

Gene RIF (19)

PMID Text
26944942 Placental PHLDA2 expression was significantly 2.3 fold higher in reduced fetal movements pregnancies resulting in delivery of a growth restricted compared with a normal birth weight infant.
26845447 TSSC3 downregulation promotes the Epithelial to mesenchymal transition (EMT) of osteosarcoma cells by regulating EMT markers via a signal transduction pathway that involves Snail, Wnt-beta-catenin/TCF, and GSK-3beta
26218012 PHLDA2 may promote the occurrence/development of preeclampsia by inhibiting proliferation/migration/invasion of trophoblasts.
24986528 The gene expression pattern of CDKN1C, H19, IGF2, KCNQ1 and PHLDA2 genes was evaluated using RT-PCR.
24953163 elevated expression in placenta of growth restricted pregnancies [review]
24703004 results suggest upregulated pleckstrin homology-like domain family A member 2 (PHLDA2) in placenta of monozygotic twins may be associated with the pathogenesis of singleton intrauterine growth restriction
24268429 TSSC3 overexpression suppressed osteosarcoma cell growth and increased apoptosis through caspase-3 upregulation, suggesting that TSSC3 may play a pro-apoptosis role to maintain the normal balance of growth
22610481 TSSC3 inhibits osteosarcoma tumorigenicity through reducing stemness and promoting apoptosis of tumor inducing cells
22444668 A luciferase reporter assay was used to identify in the PHLDA2 promoter a 15 bp repeat sequence variant that significantly reduces PHLDA2-promoter efficiency. Maternal inheritance of the variant resulted in a significant increase in birth weight.
22100507 The results suggest that placental PHLDA2 may provide a biomarker for suboptimal skeletal growth in pregnancies uncomplicated by overt fetal growth restriction.
More...

AA Sequence

MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYF      1 - 70
TIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEP     71 - 140
SRPSPQPKPRTP                                                              141 - 152
//

Text Mined References (44)

PMID Year Title
26944942 2016 Placental PHLDA2 expression is increased in cases of fetal growth restriction following reduced fetal movements.
26845447 2016 Downregulation of tumor suppressing STF cDNA 3 promotes epithelial-mesenchymal transition and tumor metastasis of osteosarcoma by the Wnt/GSK-3?/?-catenin/Snail signaling pathway.
26218012 2015 The expression of the imprinted gene pleckstrin homology-like domain family A member 2 in placental tissues of preeclampsia and its effects on the proliferation, migration and invasion of trophoblast cells JEG-3.
24986528 2014 Relevance of genomic imprinting in intrauterine human growth expression of CDKN1C, H19, IGF2, KCNQ1 and PHLDA2 imprinted genes.
24953163 2014 The significance of elevated placental PHLDA2 in human growth restricted pregnancies.
24703004 2014 Placental expression of PHLDA2 in selective intrauterine growth restriction in monozygotic twins.
24268429 2014 Epigenetic regulation of the pro-apoptosis gene TSSC3 in human osteosarcoma cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22610481 2012 TSSC3 overexpression reduces stemness and induces apoptosis of osteosarcoma tumor-initiating cells.
More...