Property Summary

NCBI Gene PubMed Count 21
Grant Count 4
R01 Count 1
Funding $131,075
PubMed Score 9.67
PubTator Score 7.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
juvenile dermatomyositis 1.119 0.000
acute quadriplegic myopathy 1.200 0.000
Breast cancer 2.900 0.025
ovarian cancer 1.400 0.010

Synonym

Accession Q53G59 A6NEN8 B7Z7B8 Q9HBX5
Symbols DKIR
C3IP1

Gene

PDB

2VPJ  

 GO Function (1)

Gene RIF (4)

PMID Text
26717573 KLHL12 promotes ubiquitination of the dopamine D4 receptor on non-lysine residues.
19536175 Observational study of gene-disease association. (HuGE Navigator)
18303015 KLHL12 specifically interacts with the D4 polymorphism, thereby building up a Cul3-E3 ligase complex with substrate specificity toward the D4 receptor
15383316 molecular cloning and characterization of a novel gene, encoded a human kelch protein containing 568 amino acid residues, termed hDKIR.

AA Sequence

MGGIMAPKDIMTNTHAKSILNSMNSLRKSNTLCDVTLRVEQKDFPAHRIVLAACSDYFCAMFTSELSEKG      1 - 70
KPYVDIQGLTASTMEILLDFVYTETVHVTVENVQELLPAACLLQLKGVKQACCEFLESQLDPSNCLGIRD     71 - 140
FAETHNCVDLMQAAEVFSQKHFPEVVQHEEFILLSQGEVEKLIKCDEIQVDSEEPVFEAVINWVKHAKKE    141 - 210
REESLPNLLQYVRMPLLTPRYITDVIDAEPFIRCSLQCRDLVDEAKKFHLRPELRSQMQGPRTRARLGAN    211 - 280
EVLLVVGGFGSQQSPIDVVEKYDPKTQEWSFLPSITRKRRYVASVSLHDRIYVIGGYDGRSRLSSVECLD    281 - 350
YTADEDGVWYSVAPMNVRRGLAGATTLGDMIYVSGGFDGSRRHTSMERYDPNIDQWSMLGDMQTAREGAG    351 - 420
LVVASGVIYCLGGYDGLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDHIYVVGGFDGTAHLSSV    421 - 490
EAYNIRTDSWTTVTSMTTPRCYVGATVLRGRLYAIAGYDGNSLLSSIECYDPIIDSWEVVTSMGTQRCDA    491 - 560
GVCVLREK                                                                  561 - 568
//

Text Mined References (24)

PMID Year Title
27565346 2016 Two Distinct Types of E3 Ligases Work in Unison to Regulate Substrate Ubiquitylation.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26717573 2015 KLHL12 Promotes Non-Lysine Ubiquitination of the Dopamine Receptors D4.2 and D4.4, but Not of the ADHD-Associated D4.7 Variant.
25416956 2014 A proteome-scale map of the human interactome network.
25243383 2015 Anti-kelch-like 12 and anti-hexokinase 1: novel autoantibodies in primary biliary cirrhosis.
24334870 2014 A regulator of secretory vesicle size, Kelch-like protein 12, facilitates the secretion of apolipoprotein B100 and very-low-density lipoproteins--brief report.
23676014 2013 Update on the Kelch-like (KLHL) gene family.
23349464 2013 Structural basis for Cul3 protein assembly with the BTB-Kelch family of E3 ubiquitin ligases.
22358839 2012 Ubiquitin-dependent regulation of COPII coat size and function.
21516116 2011 Next-generation sequencing to generate interactome datasets.
More...