Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.52
PubTator Score 4.88

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
26116899 HIV-1 Vpr upregulates the gene expression of IFI44L in human monocyte-derived dendritic cells
25620704 HIV-1 Vpr upregulates the gene expression of IFI44L in human monocyte-derived dendritic cells
25170834 HIV-1 Vpr upregulates the gene expression of IFI44L in human monocyte-derived dendritic cells
24755989 LMKB is the first protein identified to date that interacts with this portion of Ge-1. LMKB was expressed in human B and T lymphocyte cell lines; depletion of LMKB increased expression of IFI44L.
24162774 HIV-1 Vpr upregulates the gene expression of IFI44L in human monocyte-derived dendritic cells
23867815 HIV-1 Vpr upregulates the gene expression of IFI44L in human monocyte-derived dendritic cells
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCTITMAYIDYNMIVAFMLGNYI      1 - 70
NLHESSTEPNDSLWFSLQKKNDTTEIETLLLNTAPKIIDEQLVCRLSKTDIFIICRDNKIYLDKMITRNL     71 - 140
KLRFYGHRQYLECEVFRVEGIKDNLDDIKRIIKAREHRNRLLADIRDYRPYADLVSEIRILLVGPVGSGK    141 - 210
SSFFNSVKSIFHGHVTGQAVVGSDITSITERYRIYSVKDGKNGKSLPFMLCDTMGLDGAEGAGLCMDDIP    211 - 280
HILKGCMPDRYQFNSRKPITPEHSTFITSPSLKDRIHCVAYVLDINSIDNLYSKMLAKVKQVHKEVLNCG    281 - 350
IAYVALLTKVDDCSEVLQDNFLNMSRSMTSQSRVMNVHKMLGIPISNILMVGNYASDLELDPMKDILILS    351 - 420
ALRQMLRAADDFLEDLPLEETGAIERALQPCI                                          421 - 452
//

Text Mined References (12)

PMID Year Title
25344690 2014 Common variants associated with general and MMR vaccine-related febrile seizures.
24755989 2014 LMKB/MARF1 localizes to mRNA processing bodies, interacts with Ge-1, and regulates IFI44L gene expression.
24280982 2014 Polygenic dissection of diagnosis and clinical dimensions of bipolar disorder and schizophrenia.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
21478870 2011 A diverse range of gene products are effectors of the type I interferon antiviral response.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...