Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.52
PubTator Score 4.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Febrile Convulsions 11
Influenza 142
Disease Target Count P-value
juvenile dermatomyositis 1189 1.71872204314033E-30
breast carcinoma 1614 1.79266629370894E-13
lung carcinoma 2844 9.83534920340623E-13
psoriasis 6685 1.30092789864407E-11
malignant mesothelioma 3163 6.93719527298059E-9
primary Sjogren syndrome 789 4.93527358743468E-7
cutaneous lupus erythematosus 1056 2.6964141022355E-6
lung cancer 4473 8.68659260883268E-6
cystic fibrosis 1670 6.16441981258787E-5
posterior fossa group B ependymoma 1530 7.86309214128035E-5
Duchenne muscular dystrophy 602 1.26504021293875E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 1.90474332223906E-4
dermatomyositis 967 4.05960719781626E-4
pilocytic astrocytoma 3086 8.54735784491527E-4
adult high grade glioma 2148 9.43331140200506E-4
invasive ductal carcinoma 2950 0.00142189883897048
group 4 medulloblastoma 1875 0.00243619757575093
Multiple Sclerosis 498 0.00250185418294528
ulcerative colitis 2087 0.00256935286723068
pancreatic cancer 2300 0.00269853496806517
nasopharyngeal carcinoma 1056 0.0053652009498667
active Crohn's disease 918 0.0059812559935352
glioblastoma 5572 0.00705300045291363
subependymal giant cell astrocytoma 2287 0.0158405437174241
ovarian cancer 8492 0.0167278154008962
tuberculosis 1563 0.0240209362676473
uncontrolled asthma 67 0.0261076759061613
progressive supranuclear palsy 674 0.0282641270334395
inflammatory breast cancer 404 0.0311820738884765
astrocytoma 1493 0.0496850254345277
Disease Target Count Z-score Confidence
systemic lupus erythematosus 172 3.013 1.5

Expression

Synonym

Accession Q53G44 Q86TE1 Q96B64 Q99984
Symbols GS3686
C1orf29

Gene

  Ortholog (6)

Gene RIF (7)

PMID Text
26116899 HIV-1 Vpr upregulates the gene expression of IFI44L in human monocyte-derived dendritic cells
25620704 HIV-1 Vpr upregulates the gene expression of IFI44L in human monocyte-derived dendritic cells
25170834 HIV-1 Vpr upregulates the gene expression of IFI44L in human monocyte-derived dendritic cells
24755989 LMKB is the first protein identified to date that interacts with this portion of Ge-1. LMKB was expressed in human B and T lymphocyte cell lines; depletion of LMKB increased expression of IFI44L.
24162774 HIV-1 Vpr upregulates the gene expression of IFI44L in human monocyte-derived dendritic cells
23867815 HIV-1 Vpr upregulates the gene expression of IFI44L in human monocyte-derived dendritic cells
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCTITMAYIDYNMIVAFMLGNYI      1 - 70
NLHESSTEPNDSLWFSLQKKNDTTEIETLLLNTAPKIIDEQLVCRLSKTDIFIICRDNKIYLDKMITRNL     71 - 140
KLRFYGHRQYLECEVFRVEGIKDNLDDIKRIIKAREHRNRLLADIRDYRPYADLVSEIRILLVGPVGSGK    141 - 210
SSFFNSVKSIFHGHVTGQAVVGSDITSITERYRIYSVKDGKNGKSLPFMLCDTMGLDGAEGAGLCMDDIP    211 - 280
HILKGCMPDRYQFNSRKPITPEHSTFITSPSLKDRIHCVAYVLDINSIDNLYSKMLAKVKQVHKEVLNCG    281 - 350
IAYVALLTKVDDCSEVLQDNFLNMSRSMTSQSRVMNVHKMLGIPISNILMVGNYASDLELDPMKDILILS    351 - 420
ALRQMLRAADDFLEDLPLEETGAIERALQPCI                                          421 - 452
//

Text Mined References (12)

PMID Year Title
25344690 2014 Common variants associated with general and MMR vaccine-related febrile seizures.
24755989 2014 LMKB/MARF1 localizes to mRNA processing bodies, interacts with Ge-1, and regulates IFI44L gene expression.
24280982 2014 Polygenic dissection of diagnosis and clinical dimensions of bipolar disorder and schizophrenia.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
21478870 2011 A diverse range of gene products are effectors of the type I interferon antiviral response.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...