Property Summary

NCBI Gene PubMed Count 10
PubMed Score 9.02
PubTator Score 4.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
Systemic lupus erythematosus 2.900 4.2e-05
active Crohn's disease 1.804 6.0e-03
adult high grade glioma 2.200 9.4e-04
astrocytic glioma 2.100 3.2e-02
Astrocytoma, Pilocytic 1.800 7.2e-04
Breast cancer 1.800 1.1e-03
breast carcinoma 1.500 1.8e-13
cutaneous lupus erythematosus 3.800 2.7e-06
cystic fibrosis 2.696 6.2e-05
dermatomyositis 3.400 4.1e-04
Duchenne muscular dystrophy 1.213 1.3e-04
ependymoma 1.600 4.1e-03
glioblastoma 1.500 5.1e-03
group 4 medulloblastoma -1.700 2.4e-03
intraductal papillary-mucinous neoplasm ... 3.000 1.9e-04
invasive ductal carcinoma 2.110 1.4e-03
juvenile dermatomyositis 4.415 1.7e-30
lung cancer -3.900 8.7e-06
lung carcinoma -2.500 9.8e-13
malignant mesothelioma 4.900 6.9e-09
Multiple Sclerosis 4.000 2.5e-03
nasopharyngeal carcinoma 1.800 5.4e-03
ovarian cancer 1.800 1.7e-02
pancreatic cancer 1.700 2.7e-03
primary Sjogren syndrome 3.800 4.9e-07
progressive supranuclear palsy -2.200 2.8e-02
psoriasis 2.400 3.9e-05
subependymal giant cell astrocytoma 3.731 1.6e-02
tuberculosis 2.100 2.4e-02
ulcerative colitis 1.600 2.6e-03
uncontrolled asthma -1.400 2.6e-02

Synonym

Accession Q53G44 Q86TE1 Q96B64 Q99984
Symbols GS3686
C1orf29

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

AA Sequence

MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCTITMAYIDYNMIVAFMLGNYI      1 - 70
NLHESSTEPNDSLWFSLQKKNDTTEIETLLLNTAPKIIDEQLVCRLSKTDIFIICRDNKIYLDKMITRNL     71 - 140
KLRFYGHRQYLECEVFRVEGIKDNLDDIKRIIKAREHRNRLLADIRDYRPYADLVSEIRILLVGPVGSGK    141 - 210
SSFFNSVKSIFHGHVTGQAVVGSDITSITERYRIYSVKDGKNGKSLPFMLCDTMGLDGAEGAGLCMDDIP    211 - 280
HILKGCMPDRYQFNSRKPITPEHSTFITSPSLKDRIHCVAYVLDINSIDNLYSKMLAKVKQVHKEVLNCG    281 - 350
IAYVALLTKVDDCSEVLQDNFLNMSRSMTSQSRVMNVHKMLGIPISNILMVGNYASDLELDPMKDILILS    351 - 420
ALRQMLRAADDFLEDLPLEETGAIERALQPCI                                          421 - 452
//

Text Mined References (13)

PMID Year Title