Property Summary

NCBI Gene PubMed Count 28
PubMed Score 25.53
PubTator Score 57.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma 1.435 2.4e-02
colon cancer -2.200 2.5e-02
gastric carcinoma -2.700 1.1e-02
interstitial cystitis -1.800 4.8e-03
intraductal papillary-mucinous carcinoma... -1.200 4.7e-02
intraductal papillary-mucinous neoplasm ... -1.400 3.7e-02
lung cancer -2.100 2.6e-04
lung carcinoma -2.100 7.3e-27
medulloblastoma, large-cell 1.100 4.2e-04
nephrosclerosis -1.161 2.8e-02
non diabetic and post-ischemic heart fai... 1.100 2.0e-02
osteosarcoma -1.961 3.5e-06
pancreatic ductal adenocarcinoma liver m... -1.410 4.9e-03
psoriasis -1.200 1.7e-03
ulcerative colitis -1.300 3.1e-03

Gene RIF (25)

AA Sequence

MLARVTRKMLRHAKCFQRLAIFGSVRALHKDNRTATPQNFSNYESMKQDFKLGIPEYFNFAKDVLDQWTD      1 - 70
KEKAGKKPSNPAFWWINRNGEEMRWSFEELGSLSRKFANILSEACSLQRGDRVILILPRVPEWWLANVAC     71 - 140
LRTGTVLIPGTTQLTQKDILYRLQSSKANCIITNDVLAPAVDAVASKCENLHSKLIVSENSREGWGNLKE    141 - 210
LMKHASDSHTCVKTKHNEIMAIFFTSGTSGYPKMTAHTHSSFGLGLSVNGRFWLDLTPSDVMWNTSDTGW    211 - 280
AKSAWSSVFSPWIQGACVFTHHLPRFEPTSILQTLSKYPITVFCSAPTVYRMLVQNDITSYKFKSLKHCV    281 - 350
SAGEPITPDVTEKWRNKTGLDIYEGYGQTETVLICGNFKGMKIKPGSMGKPSPAFDVKIVDVNGNVLPPG    351 - 420
QEGDIGIQVLPNRPFGLFTHYVDNPSKTASTLRGNFYITGDRGYMDKDGYFWFVARADDVILSSGYRIGP    421 - 490
FEVENALNEHPSVAESAVVSSPDPIRGEVVKAFVVLNPDYKSHDQEQLIKEIQEHVKKTTAPYKYPRKVE    491 - 560
FIQELPKTISGKTKRNELRKKEWKTI                                                561 - 586
//

Text Mined References (31)

PMID Year Title