Property Summary

NCBI Gene PubMed Count 28
PubMed Score 20.01
PubTator Score 57.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Prostatic Neoplasms 471
Disease Target Count P-value
lung carcinoma 2844 7.2895649713119E-27
psoriasis 6685 8.74049736447066E-26
osteosarcoma 7933 1.19586991257564E-6
interstitial cystitis 2299 6.57411713802459E-5
lung cancer 4473 2.59648311850564E-4
medulloblastoma, large-cell 6234 4.24342666635813E-4
ulcerative colitis 2087 0.00310413864544101
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00488206163629557
gastric carcinoma 832 0.0112523882782761
adrenocortical carcinoma 1427 0.0176774557947499
non diabetic and post-ischemic heart failure 200 0.0201015187528982
colon cancer 1475 0.0249744747557663
nephrosclerosis 329 0.0279709113298822
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0368654268676972
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.04656431171545

Expression

Synonym

Accession Q53FZ2 O60363 Q13732 Q15425 Q7KYM6 Q9BUA2
Symbols SA
SAH

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

 MGI Term (1)

Gene RIF (25)

PMID Text
21987487 Reduced ACSM3 is associated with impaired butyrate oxidation in ulcerative colitis.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20679960 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19262474 left ventricular mass index and mean wall thickness , two phenotypes that are jointly influenced by blood pressure and obesity, might be related to variation in the human SAH gene
19262474 Observational study of gene-disease association. (HuGE Navigator)
19108963 SA hypertension-associated homolog(SAH) gene polymorphisms are associated with non-high-density lipoprotein cholesterol in postmenopausal women
More...

AA Sequence

MLARVTRKMLRHAKCFQRLAIFGSVRALHKDNRTATPQNFSNYESMKQDFKLGIPEYFNFAKDVLDQWTD      1 - 70
KEKAGKKPSNPAFWWINRNGEEMRWSFEELGSLSRKFANILSEACSLQRGDRVILILPRVPEWWLANVAC     71 - 140
LRTGTVLIPGTTQLTQKDILYRLQSSKANCIITNDVLAPAVDAVASKCENLHSKLIVSENSREGWGNLKE    141 - 210
LMKHASDSHTCVKTKHNEIMAIFFTSGTSGYPKMTAHTHSSFGLGLSVNGRFWLDLTPSDVMWNTSDTGW    211 - 280
AKSAWSSVFSPWIQGACVFTHHLPRFEPTSILQTLSKYPITVFCSAPTVYRMLVQNDITSYKFKSLKHCV    281 - 350
SAGEPITPDVTEKWRNKTGLDIYEGYGQTETVLICGNFKGMKIKPGSMGKPSPAFDVKIVDVNGNVLPPG    351 - 420
QEGDIGIQVLPNRPFGLFTHYVDNPSKTASTLRGNFYITGDRGYMDKDGYFWFVARADDVILSSGYRIGP    421 - 490
FEVENALNEHPSVAESAVVSSPDPIRGEVVKAFVVLNPDYKSHDQEQLIKEIQEHVKKTTAPYKYPRKVE    491 - 560
FIQELPKTISGKTKRNELRKKEWKTI                                                561 - 586
//

Text Mined References (31)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21987487 2012 Impaired butyrate oxidation in ulcerative colitis is due to decreased butyrate uptake and a defect in the oxidation pathway.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19262474 2009 Left ventricular structure in relation to the human SAH gene in the European Project on Genes in Hypertension.
More...