Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.61
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
Astrocytoma, Pilocytic 1.300 2.0e-07
atypical teratoid / rhabdoid tumor 1.100 2.0e-03
Breast cancer 1.100 4.8e-10
ependymoma 1.300 2.3e-12
glioblastoma 1.200 3.0e-06
invasive ductal carcinoma 1.100 1.4e-03
Multiple myeloma 1.626 1.0e-03
ovarian cancer 2.400 1.7e-06
pediatric high grade glioma 1.300 5.5e-05
psoriasis 1.200 1.0e-10

Synonym

Accession Q53FV1 B2RA58 Q7Z4E5 Q8NFX0 Q9P004
Symbols MST095
HSPC160
MSTP095
adoplin-2

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (2)

AA Sequence

MNVGVAHSEVNPNTRVMNSRGIWLAYIILVGLLHMVLLSIPFFSIPVVWTLTNVIHNLATYVFLHTVKGT      1 - 70
PFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPIVLYLLASFYTKYDAAHFLINTASLLSVLLPKLP     71 - 140
QFHGVRVFGINKY                                                             141 - 153
//

Text Mined References (12)

PMID Year Title