Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.57
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.626 0.001
posterior fossa group B ependymoma 1.500 0.000
glioblastoma 1.700 0.002
atypical teratoid / rhabdoid tumor 1.100 0.002
pediatric high grade glioma 1.300 0.000
pilocytic astrocytoma 1.300 0.000
psoriasis 1.200 0.000
Breast cancer 1.100 0.000
invasive ductal carcinoma 1.100 0.001
ovarian cancer 2.400 0.000

Synonym

Accession Q53FV1 B2RA58 Q7Z4E5 Q8NFX0 Q9P004
Symbols MST095
HSPC160
MSTP095
adoplin-2

Gene

Gene RIF (2)

PMID Text
25395622 Expression of the ORMDLS, modulators of serine palmitoyltransferase, is regulated by sphingolipids in mammalian cells.
23066021 ORMDL1, ORMDL2 and ORMDL3 mediate the feedback response in ceramide biosynthesis.

AA Sequence

MNVGVAHSEVNPNTRVMNSRGIWLAYIILVGLLHMVLLSIPFFSIPVVWTLTNVIHNLATYVFLHTVKGT      1 - 70
PFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPIVLYLLASFYTKYDAAHFLINTASLLSVLLPKLP     71 - 140
QFHGVRVFGINKY                                                             141 - 153
//

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25691431 2015 ORMDL/serine palmitoyltransferase stoichiometry determines effects of ORMDL3 expression on sphingolipid biosynthesis.
25395622 2015 Expression of the ORMDLS, modulators of serine palmitoyltransferase, is regulated by sphingolipids in mammalian cells.
23066021 2012 Mammalian ORMDL proteins mediate the feedback response in ceramide biosynthesis.
20182505 2010 Orm family proteins mediate sphingolipid homeostasis.
17928364 2008 A family of membrane proteins associated with presenilin expression and gamma-secretase function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12093374 2002 ORMDL proteins are a conserved new family of endoplasmic reticulum membrane proteins.
More...