Property Summary

NCBI Gene PubMed Count 14
PubMed Score 12.41
PubTator Score 6.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
acute myeloid leukemia -1.300 0.042
ovarian cancer 1.600 0.000

Synonym

Accession Q53FT3 Q8WVE8 Q9NVQ2 Q9NZZ1 Q9P022 Q9P0N1
Symbols HLD13
L7RN6
OPI10
HSPC138
HSPC179
C11orf73

Gene

PDB

3WVZ   3WW0  

Gene RIF (3)

PMID Text
26545878 Leukoencephalopathy and early death associated with an Ashkenazi-Jewish founder mutation in the Hikeshi gene.P.V54L mutation in Hikeshi is associated with absence of nuclear HSP70 during heat shock stress.
25760597 The crystal structure of Hikeshi explains how Hikeshi participates in the regulation of nuclear import through the recognition of FG-Nups and which part of Hikeshi affects its binding to Hsp70.
22541429 identify a nuclear import pathway that operates during heat shock stress and is mediated by an evolutionarily conserved protein, Hikeshi (coded by the C11orf73 gene) binds to FG-Nups and translocates through nuclear pores on its own, showing characteristic features of nuclear transport carriers.

AA Sequence

MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLL      1 - 70
GFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQ     71 - 140
FTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWKT                 141 - 197
//

Text Mined References (16)

PMID Year Title
26545878 2016 Leukoencephalopathy and early death associated with an Ashkenazi-Jewish founder mutation in the Hikeshi gene.
26523678 2016 Structural Biology and Regulation of Protein Import into the Nucleus.
25760597 2015 Structural and functional analysis of Hikeshi, a new nuclear transport receptor of Hsp70s.
25484218 2014 Crystallization and preliminary X-ray crystallographic study of human Hikeshi, a new nuclear transport receptor for Hsp70.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22895094 Heat-shock stress activates a novel nuclear import pathway mediated by Hikeshi.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22541429 2012 Hikeshi, a nuclear import carrier for Hsp70s, protects cells from heat shock-induced nuclear damage.
21269460 2011 Initial characterization of the human central proteome.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
More...