Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.200 9.1e-05
astrocytic glioma -1.700 9.1e-03
atypical teratoid / rhabdoid tumor -2.500 3.1e-03
colon cancer -2.700 2.0e-09
cystic fibrosis 1.204 8.9e-04
ductal carcinoma in situ -1.600 2.0e-03
ependymoma -2.900 2.8e-02
glioblastoma -1.500 4.0e-04
invasive ductal carcinoma -2.000 3.2e-03
medulloblastoma, large-cell -3.900 2.3e-04
oligodendroglioma -1.100 2.0e-07
Pick disease -1.200 3.2e-02
pituitary cancer 2.900 2.2e-06
psoriasis -1.400 2.7e-33

Synonym

Accession Q53FP2 Q9H7Y3
Symbols TMEM35

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MASPRTVTIVALSVALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVRALPLLKKMGINSILLRKSIGA      1 - 70
LEVACGIVMTLVPGRPKDVANFFLLLLVLAVLFFHQLVGDPLKRYAHALVFGILLTCRLLIARKPEDRSS     71 - 140
EKKPLPGNAEEQPSLYEKAPQGKVKVS                                               141 - 167
//

Text Mined References (6)

PMID Year Title