Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 2.69126493038069E-33
glioblastoma multiforme 347 3.85389460864403E-17
colon cancer 1475 2.02295637113484E-9
oligodendroglioma 2849 2.04390241077303E-7
pituitary cancer 1972 2.24097281635342E-6
adult high grade glioma 2148 9.10787667715044E-5
medulloblastoma, large-cell 6234 2.25794955356592E-4
cystic fibrosis 1670 8.88384228257162E-4
ductal carcinoma in situ 1745 0.00198688121254877
atypical teratoid / rhabdoid tumor 4369 0.00309866722669889
invasive ductal carcinoma 2950 0.00323562448155653
astrocytic glioma 2241 0.00909809715950994
ependymoma 2514 0.0278270040817705
Pick disease 1893 0.0323179965034876

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.700 0.009
ependymoma -2.900 0.028
glioblastoma multiforme -2.100 0.000
oligodendroglioma -1.100 0.000
cystic fibrosis 1.204 0.001
atypical teratoid / rhabdoid tumor -2.500 0.003
medulloblastoma, large-cell -3.900 0.000
colon cancer -2.700 0.000
adult high grade glioma -2.200 0.000
Pick disease -1.200 0.032
ductal carcinoma in situ -1.600 0.002
invasive ductal carcinoma -2.000 0.003
pituitary cancer 2.900 0.000
psoriasis -1.400 0.000

Synonym

Accession Q53FP2 Q9H7Y3
Symbols TMEM35

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid

AA Sequence

MASPRTVTIVALSVALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVRALPLLKKMGINSILLRKSIGA      1 - 70
LEVACGIVMTLVPGRPKDVANFFLLLLVLAVLFFHQLVGDPLKRYAHALVFGILLTCRLLIARKPEDRSS     71 - 140
EKKPLPGNAEEQPSLYEKAPQGKVKVS                                               141 - 167
//

Text Mined References (6)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.