Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.700 0.009
ependymoma -2.900 0.028
glioblastoma multiforme -2.100 0.000
oligodendroglioma -1.100 0.000
cystic fibrosis 1.204 0.001
atypical teratoid / rhabdoid tumor -2.500 0.003
medulloblastoma, large-cell -3.900 0.000
colon cancer -2.700 0.000
adult high grade glioma -2.200 0.000
Pick disease -1.200 0.032
ductal carcinoma in situ -1.600 0.002
invasive ductal carcinoma -2.000 0.003
pituitary cancer 2.900 0.000
psoriasis -1.400 0.000

Synonym

Accession Q53FP2 Q9H7Y3
Symbols TMEM35

Gene

AA Sequence

MASPRTVTIVALSVALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVRALPLLKKMGINSILLRKSIGA      1 - 70
LEVACGIVMTLVPGRPKDVANFFLLLLVLAVLFFHQLVGDPLKRYAHALVFGILLTCRLLIARKPEDRSS     71 - 140
EKKPLPGNAEEQPSLYEKAPQGKVKVS                                               141 - 167
//

Text Mined References (6)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.