Property Summary

NCBI Gene PubMed Count 33
Grant Count 27
R01 Count 23
Funding $2,833,247.85
PubMed Score 5.12
PubTator Score 32.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (22)

PMID Text
26464464 PIG3, which functions in DNA damage repair, uses an unexpected catalytic mechanism to suppress Rho-ROCK activity and impair tumor invasion in vivo. This regulation was suppressed by antioxidants.
26133772 The results suggested that PIG3 plays an oncogenic role in PTC via the regulation of the PI3K/AKT/PTEN pathway and support the exploration of PIG3 as a novel biomarker for patients with papillary thyroid carcinoma
24388982 prohibitin and prohibiton (PHB2) contribute to PIG3-mediated apoptosis by binding to the PIG3 promoter (TGYCC)15 motif
23241165 study provides evidence that the variant genotypes of (TGYCC)n repeats in the PIG3 promoter are functional and associated with risk of squamous cell carcinoma of the head and neck in a non-Hispanic white population
22461624 a novel signaling pathway of GPx3-PIG3 in the regulation of cell death in prostate cancer.
20603616 certain p53 mutatants activate PIG3, whereas the result of our study show increased full-length transcript expression in tumor counterparts
20453000 Observational study of gene-disease association. (HuGE Navigator)
20023697 Results suggest that PIG3 is a critical component of the DNA damage response pathway and has a direct role in the transmission of the DNA damage signal from damaged DNA to the intra-S and G2/M checkpoint machinery.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVA      1 - 70
ELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQA     71 - 140
GDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGV    141 - 210
NLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNA    211 - 280
FTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ                      281 - 332
//

Text Mined References (35)

PMID Year Title
26464464 2016 Reactivation of p53 by a Cytoskeletal Sensor to Control the Balance Between DNA Damage and Tumor Dissemination.
26133772 2015 PIG3 plays an oncogenic role in papillary thyroid cancer by activating the PI3K/AKT/PTEN pathway.
24388982 2014 Identification of prohibitin and prohibiton as novel factors binding to the p53 induced gene 3 (PIG3) promoter (TGYCC)(15) motif.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23241165 2013 Functional repeats (TGYCC)n in the p53-inducible gene 3 (PIG3) promoter and susceptibility to squamous cell carcinoma of the head and neck.
22461624 2012 p53-induced gene 3 mediates cell death induced by glutathione peroxidase 3.
21269460 2011 Initial characterization of the human central proteome.
20603616 2010 Why is p53-inducible gene 3 rarely affected in cancer?
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20023697 2010 The p53-inducible gene 3 (PIG3) contributes to early cellular response to DNA damage.
More...