Property Summary

NCBI Gene PubMed Count 37
PubMed Score 5.42
PubTator Score 32.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Astrocytoma, Pilocytic 1.700 9.9e-08
atypical teratoid / rhabdoid tumor 2.600 1.0e-06
glioblastoma 1.500 1.4e-08
group 3 medulloblastoma 1.100 1.1e-03
lung cancer 2.200 7.1e-04
malignant mesothelioma -4.100 4.0e-09
oligodendroglioma 1.100 9.3e-10
ovarian cancer -1.100 1.1e-03
pediatric high grade glioma 1.700 9.0e-08
primitive neuroectodermal tumor 1.600 8.1e-05
subependymal giant cell astrocytoma 3.189 1.2e-02
tuberculosis 1.200 8.1e-06

Gene RIF (26)

AA Sequence

MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVA      1 - 70
ELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQA     71 - 140
GDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGV    141 - 210
NLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNA    211 - 280
FTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ                      281 - 332
//

Text Mined References (39)

PMID Year Title