Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.78
PubTator Score 7.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Bipolar Disorder 666
Disease Target Count P-value
osteosarcoma 7950 2.6e-07

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.540 2.6e-07

Gene RIF (5)

AA Sequence

MAMIELGFGRQNFHPLKRKSSLLLKLIAVVFAVLLFCEFLIYYLAIFQCNWPEVKTTASDGEQTTREPVL      1 - 70
KAMFLADTHLLGEFLGHWLDKLRREWQMERAFQTALWLLQPEVVFILGDIFDEGKWSTPEAWADDVERFQ     71 - 140
KMFRHPSHVQLKVVAGNHDIGFHYEMNTYKVERFEKVFSSERLFSWKGINFVMVNSVALNGDGCGICSET    141 - 210
EAELIEVSHRLNCSREARGSSRCGPGPLLPTSAPVLLQHYPLYRRSDANCSGEDAAPAEERDIPFKENYD    211 - 280
VLSREASQKLLWWLQPRLVLSGHTHSACEVHHGGRVPELSVPSFSWRNRNNPSFIMGSITPTDYTLSKCY    281 - 350
LPREDVVLIIYCGVVGFLVVLTLTHFGLLASPFLSGLNLLGKRKTR                            351 - 396
//

Text Mined References (13)

PMID Year Title