Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.78
PubTator Score 7.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Bipolar Disorder 266 3.135 1.6
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.661 0.000

Gene

PANTHER Protein Class (2)

Gene RIF (5)

PMID Text
19859903 These results provide evidence of an association between a polymorphism in the MPPE1 gene and bipolar disorder.
19859903 Observational study of gene-disease association. (HuGE Navigator)
19837036 Data demonstrate that glycosylphosphatidylinositol(GPI) glycan acts as an endoplasmic reticulum-exit signal and suggest that glycan remodeling mediated by PGAP5 regulates GPI-anchored proteins transport in the early secretory pathway.
19328558 Observational study of gene-disease association. (HuGE Navigator)
11978971 cDNA cloning, genomic organization and expression of the novel human metallophosphoesterase gene MPPE1 on chromosome 18p11.2

AA Sequence

MAMIELGFGRQNFHPLKRKSSLLLKLIAVVFAVLLFCEFLIYYLAIFQCNWPEVKTTASDGEQTTREPVL      1 - 70
KAMFLADTHLLGEFLGHWLDKLRREWQMERAFQTALWLLQPEVVFILGDIFDEGKWSTPEAWADDVERFQ     71 - 140
KMFRHPSHVQLKVVAGNHDIGFHYEMNTYKVERFEKVFSSERLFSWKGINFVMVNSVALNGDGCGICSET    141 - 210
EAELIEVSHRLNCSREARGSSRCGPGPLLPTSAPVLLQHYPLYRRSDANCSGEDAAPAEERDIPFKENYD    211 - 280
VLSREASQKLLWWLQPRLVLSGHTHSACEVHHGGRVPELSVPSFSWRNRNNPSFIMGSITPTDYTLSKCY    281 - 350
LPREDVVLIIYCGVVGFLVVLTLTHFGLLASPFLSGLNLLGKRKTR                            351 - 396
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19859903 2010 Association between polymorphisms in the metallophosphoesterase (MPPE1) gene and bipolar disorder.
19837036 2009 GPI glycan remodeling by PGAP5 regulates transport of GPI-anchored proteins from the ER to the Golgi.
19328558 2009 Case-control association study of 65 candidate genes revealed a possible association of a SNP of HTR5A to be a factor susceptible to bipolar disease in Bulgarian population.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15252450 2004 Lineage-specific gene duplication and loss in human and great ape evolution.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...