Property Summary

NCBI Gene PubMed Count 42
Grant Count 3
R01 Count 2
Funding $234,213.86
PubMed Score 32.70
PubTator Score 21.63

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q53EZ4 B2RDG8 Q32WF5 Q3MV20 Q5VY28 Q6N034 Q96H32 Q9NVS7 Cep55
Symbols CT111
URCC6
C10orf3

Gene

PDB

3E1R   3WUV   3WUT   3WUU  

Gene RIF (21)

PMID Text
25915844 In depth discussion of the functions of CEP55 across different effector pathways, and also its roles as a biomarker and driver of tumorigenesis, commemorating a decade of research on CEP55. [review]
25889801 Which was required for FLJ10540/MMP-7 or FLJ10540/MMP-10 expressions.
25659891 myotubularin-related protein 3 and myotubularin-related protein 4 may act as a bridge between CEP55 and polo-like kinase 1, ensuring proper CEP55 phosphorylation and regulating CEP55 recruitment to the midbody.
25178936 CEP55 mRNA/protein expression was observed is specific to TCC of human urinary bladder and might be used as a diagnostic biomarker and vaccine target in development of BC specific immunotherapy.
24390615 cellular proliferation was suppressed as a result of cell cycle arrest at the G2/M phase in CEP55-knockdown cells
22771033 At the midbody, BRCA2 influences the recruitment of endosomal sorting complex required for transport (ESCRT)-associated proteins, Alix and Tsg101, and formation of CEP55-Alix and CEP55-Tsg101 complexes during abscission.
22591637 FLJ10540 may be critical regulator of disease progression in nasopharygeal carcinoma, and the underlying mechanism may involve in the osteopontin/CD44 pathway.
22184120 the existence of a p53-Plk1-Cep55 axis in which p53 negatively regulates expression of Cep55, through Plk1 which, in turn, is a positive regulator of Cep55 protein stability.
21079244 Data show that Plk1 activity negatively regulates Cep55 to ensure orderly abscission factor recruitment and ensures that this occurs only once cell contraction has completed.
20400365 Data provide strong evidence that CEP55 and HELLS may be used in conjunction with FOXM1 as a biomarker set for early cancer detection and indicators of malignant conversion and progression.
More...

AA Sequence

MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGKLTDKERHRLLEKIRVLEAEK      1 - 70
EKNAYQLTEKDKEIQRLRDQLKARYSTTTLLEQLEETTREGERREQVLKALSEEKDVLKQQLSAATSRIA     71 - 140
ELESKTNTLRLSQTVAPNCFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTE    141 - 210
TAAHSLPQQTKKPESEGYLQEEKQKCYNDLLASAKKDLEVERQTITQLSFELSEFRRKYEETQKEVHNLN    211 - 280
QLLYSQRRADVQHLEDDRHKTEKIQKLREENDIARGKLEEEKKRSEELLSQVQFLYTSLLKQQEEQTRVA    281 - 350
LLEQQMQACTLDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPLVTFQGETENRE    351 - 420
KVAASPKSPTAALNESLVECPKCNIQYPATEHRDLLVHVEYCSK                              421 - 464
//

Text Mined References (51)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25915844 2016 Beyond cytokinesis: the emerging roles of CEP55 in tumorigenesis.
25889801 2015 Suppression of Aurora-A-FLJ10540 signaling axis prohibits the malignant state of head and neck cancer.
25659891 2015 Myotubularin-related proteins 3 and 4 interact with polo-like kinase 1 and centrosomal protein of 55 kDa to ensure proper abscission.
25449601 2015 Upregulation of FLJ10540, a PI3K-association protein, in rostral ventrolateral medulla impairs brain stem cardiovascular regulation during mevinphos intoxication.
25178936 2015 Expression and clinical significance of Centrosomal protein 55 (CEP55) in human urinary bladder transitional cell carcinoma.
24390615 2014 CEP55 contributes to human gastric carcinoma by regulating cell proliferation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23045692 2012 ESCRT-III binding protein MITD1 is involved in cytokinesis and has an unanticipated PLD fold that binds membranes.
22771033 2012 BRCA2 localization to the midbody by filamin A regulates cep55 signaling and completion of cytokinesis.
More...