Property Summary

NCBI Gene PubMed Count 54
PubMed Score 36.17
PubTator Score 21.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
active Crohn's disease 1.086 1.8e-02
adrenocortical carcinoma 2.817 1.9e-04
adult high grade glioma 2.400 1.0e-04
Astrocytoma, Pilocytic 1.500 1.5e-05
Atopic dermatitis 2.700 4.5e-06
atypical teratoid / rhabdoid tumor 3.900 3.1e-11
Breast cancer 3.600 2.2e-02
breast carcinoma 1.600 1.6e-06
colon cancer 1.700 3.4e-02
ductal carcinoma in situ 2.700 8.1e-04
Endometriosis 1.913 1.3e-02
ependymoma 2.100 3.3e-08
esophageal adenocarcinoma 1.400 2.1e-02
glioblastoma 3.500 5.8e-11
group 3 medulloblastoma 4.200 3.0e-07
interstitial cystitis 1.400 9.6e-03
intraductal papillary-mucinous carcinoma... 2.900 2.5e-05
intraductal papillary-mucinous neoplasm ... 3.100 1.3e-03
invasive ductal carcinoma 3.500 2.9e-05
lung adenocarcinoma 1.100 1.4e-06
lung cancer 3.900 5.2e-05
medulloblastoma, large-cell 4.500 8.8e-08
nasopharyngeal carcinoma 1.700 1.7e-04
non primary Sjogren syndrome sicca -1.300 2.2e-02
non-small cell lung cancer 3.477 6.7e-37
ovarian cancer 3.100 1.0e-05
pancreatic cancer 1.700 1.5e-06
primitive neuroectodermal tumor 3.800 3.9e-06
psoriasis 1.200 2.4e-05
ulcerative colitis 1.900 4.7e-06

Gene RIF (25)

AA Sequence

MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGKLTDKERHRLLEKIRVLEAEK      1 - 70
EKNAYQLTEKDKEIQRLRDQLKARYSTTTLLEQLEETTREGERREQVLKALSEEKDVLKQQLSAATSRIA     71 - 140
ELESKTNTLRLSQTVAPNCFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTE    141 - 210
TAAHSLPQQTKKPESEGYLQEEKQKCYNDLLASAKKDLEVERQTITQLSFELSEFRRKYEETQKEVHNLN    211 - 280
QLLYSQRRADVQHLEDDRHKTEKIQKLREENDIARGKLEEEKKRSEELLSQVQFLYTSLLKQQEEQTRVA    281 - 350
LLEQQMQACTLDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPLVTFQGETENRE    351 - 420
KVAASPKSPTAALNESLVECPKCNIQYPATEHRDLLVHVEYCSK                              421 - 464
//

Text Mined References (64)

PMID Year Title