Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.28
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 3.5e-09
nasopharyngeal carcinoma 1058 1.7e-07
Disease Target Count Z-score Confidence
Ciliopathy 71 4.488 2.2

Expression

  Differential Expression (2)

Disease log2 FC p
ependymoma 1.800 3.5e-09
nasopharyngeal carcinoma -1.200 1.7e-07

AA Sequence

MSDEDDLEDSEPDQDDSEKEEDEKETEEGEDYRKEGEEFPEEWLPTPLTEDMMKEGLSLLCKTGNGLAHA      1 - 70
YVKLEVKERDLTDIYLLRSYIHLRYVDISENHLTDLSPLNYLTHLLWLKADGNRLRSAQMNELPYLQIAS     71 - 140
FAYNQITDTEGISHPRLETLNLKGNSIHMVTGLDPEKLISLHTVELRGNQLESTLGINLPKLKNLYLAQN    141 - 210
MLKKVEGLEDLSNLTTLHLRDNQIDTLSGFSREMKSLQYLNLRGNMVANLGELAKLRDLPKLRALVLLDN    211 - 280
PCTDETSYRQEALVQMPYLERLDKEFYEEEERAEADVIRQRLKEEKEQEPEPQRDLEPEQSLI           281 - 343
//

Text Mined References (11)

PMID Year Title