Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.08
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.8148032328082E-14
nasopharyngeal carcinoma 1056 1.74381717753827E-7

Expression

  Differential Expression (2)

Disease log2 FC p
posterior fossa group B ependymoma 2.800 0.000
nasopharyngeal carcinoma -1.200 0.000

Synonym

Accession Q53EV4 A8K8C6 D3DUT1 Q8N6K6 Q92977 Q99620
Symbols LRPB7

Gene

PANTHER Protein Class (1)

  Ortholog (8)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Xenopus OMA Inparanoid

AA Sequence

MSDEDDLEDSEPDQDDSEKEEDEKETEEGEDYRKEGEEFPEEWLPTPLTEDMMKEGLSLLCKTGNGLAHA      1 - 70
YVKLEVKERDLTDIYLLRSYIHLRYVDISENHLTDLSPLNYLTHLLWLKADGNRLRSAQMNELPYLQIAS     71 - 140
FAYNQITDTEGISHPRLETLNLKGNSIHMVTGLDPEKLISLHTVELRGNQLESTLGINLPKLKNLYLAQN    141 - 210
MLKKVEGLEDLSNLTTLHLRDNQIDTLSGFSREMKSLQYLNLRGNMVANLGELAKLRDLPKLRALVLLDN    211 - 280
PCTDETSYRQEALVQMPYLERLDKEFYEEEERAEADVIRQRLKEEKEQEPEPQRDLEPEQSLI           281 - 343
//

Text Mined References (11)

PMID Year Title
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16030496 2005 Expression and localization of leucine-rich B7 protein in human ocular tissues.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9074930 1997 Large-scale sequencing in human chromosome 12p13: experimental and computational gene structure determination.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8723724 1996 A gene-rich cluster between the CD4 and triosephosphate isomerase genes at human chromosome 12p13.
More...