Property Summary

NCBI Gene PubMed Count 14
Grant Count 5
Funding $828,345
PubMed Score 29.49
PubTator Score 32.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
osteosarcoma -2.859 0.001
group 4 medulloblastoma -1.300 0.000
medulloblastoma, large-cell -1.200 0.000
tuberculosis -1.200 0.018
non-small cell lung cancer -1.049 0.000
intraductal papillary-mucinous adenoma (... 1.700 0.027
intraductal papillary-mucinous neoplasm ... 2.200 0.039
cystic fibrosis 1.500 0.000
spina bifida -1.902 0.048
Breast cancer -2.000 0.000
invasive ductal carcinoma -2.200 0.009
ovarian cancer -1.500 0.000
pituitary cancer 1.100 0.002

Synonym

Accession Q53EU6 Q68CJ4 Q6GPI6 Q96NA3 GPAT-3
Symbols MAG1
AGPAT8
AGPAT9
AGPAT10
AGPAT 10
HMFN0839
LPAAT-theta

Gene

Gene RIF (4)

PMID Text
26110566 Data show that 1-acylglycerol-3-phosphate O-acyltransferase 9 (AGPAT9) inhibit cell growth by regulating expression of KLF4/LASS2/V-ATPase proteins in breast cancer.
22985252 findings identified a direct role that mag-1 played in metastasis and implicated its function in cellular adaptation to tumour microenvironment
20181984 Results reveal a link between the lipogenic effects of insulin and microsomal GPAT3 and GPAT4, implying their importance in glycerolipid biosynthesis.
17002884 LPAAT-theta gene consisted of 12 exons and 11 introns, and mapped to chromosome 4q21.23, was ubiquitously expressed in 18 human tissues and overexpression of LPAAT-theta can induce mTOR-dependent p70S6K and 4EBP1 phosphorylation in HEK293T cells.

AA Sequence

MEGAELAGKILSTWLTLVLGFILLPSVFGVSLGISEIYMKILVKTLEWATIRIEKGTPKESILKNSASVG      1 - 70
IIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEELVSWNLLTRTNVNFQYISLR     71 - 140
LTMVWVLGVIVRYCVLLPLRVTLAFIGISLLVIGTTLVGQLPDSSLKNWLSELVHLTCCRICVRALSGTI    141 - 210
HYHNKQYRPQKGGICVANHTSPIDVLILTTDGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEMKDRH    211 - 280
LVTKRLKEHIADKKKLPILIFPEGTCINNTSVMMFKKGSFEIGGTIHPVAIKYNPQFGDAFWNSSKYNMV    281 - 350
SYLLRMMTSWAIVCDVWYMPPMTREEGEDAVQFANRVKSAIAIQGGLTELPWDGGLKRAKVKDIFKEEQQ    351 - 420
KNYSKMIVGNGSLS                                                            421 - 434
//

Text Mined References (19)

PMID Year Title
26110566 2015 AGPAT9 suppresses cell growth, invasion and metastasis by counteracting acidic tumor microenvironment through KLF4/LASS2/V-ATPase signaling pathway in breast cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22985252 2012 Metastasis-associated gene, mag-1 improves tumour microenvironmental adaptation and potentiates tumour metastasis.
21310131 2003 [Identification of novel metastasis associated genes MAG-1 and MAG-2].
20181984 2010 GPAT3 and GPAT4 are regulated by insulin-stimulated phosphorylation and play distinct roles in adipogenesis.
19318427 2009 Functional characterization of the human 1-acylglycerol-3-phosphate-O-acyltransferase isoform 10/glycerol-3-phosphate acyltransferase isoform 3.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17170135 2006 Molecular identification of microsomal acyl-CoA:glycerol-3-phosphate acyltransferase, a key enzyme in de novo triacylglycerol synthesis.
More...