Property Summary

NCBI Gene PubMed Count 60
Grant Count 24
R01 Count 21
Funding $1,517,159.02
PubMed Score 31.58
PubTator Score 74.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia 1.100 0.018

Gene RIF (43)

PMID Text
26652733 CRTC2 strongly enhances GR-induced transcriptional activity of glucocorticoid-responsive genes.
26438156 critical pathophysiologic event in the evolution of HER2-amplified cancers is the loss of the input signals that normally drive TORC2 signaling, repositioning it under Akt dependency, and fundamentally altering the role of HER3
26432405 In neuroblastoma, transcription of HIF2A is strongly dependent on mTORC2.
26004186 Our results establish a role for CRTC2 as a lymphoma tumor suppressor gene
25256670 the high expression of CRTC2 and PROM1 may play an important role in the occurrence and hereditary, and also advance the potential pathways that integrate genetic variants in the development of NSCLC.
24529027 These results clearly indicate that non-phosphorylated CRTC2 strongly enhances hepatitis b virus biosynthesis through inducing PGC1alpha expression.
24484648 The data from the current study demonstrated novel PROM1 and CRTC2 mutations, which could promote lung cancer development.
23671120 CRTC2 enhances CREB phosphorylation through an association with the protein arginine methyltransferase 5 (PRMT5).
23584792 Phosphorylation of CRTC2 at its AMPK target site, Ser 171, dictated its subcellular localization, and the activation of aromatase PII in preadipocytes.
23459592 we found that overexpressed RIOK2 formed a complex with RIOK1, mTor, and mTor-complex-2(TORC2) components, and that overexpressed RIOK2 upregulated Akt signaling and promoted tumorigenesis
More...

AA Sequence

MATSGANGPGSATASASNPRKFSEKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLAYTRSSHYGGS      1 - 70
LPNVNQIGSGLAEFQSPLHSPLDSSRSTRHHGLVERVQRDPRRMVSPLRRYTRHIDSSPYSPAYLSPPPE     71 - 140
SSWRRTMAWGNFPAEKGQLFRLPSALNRTSSDSALHTSVMNPSPQDTYPGPTPPSILPSRRGGILDGEMD    141 - 210
PKVPAIEENLLDDKHLLKPWDAKKLSSSSSRPRSCEVPGINIFPSPDQPANVPVLPPAMNTGGSLPDLTN    211 - 280
LHFPPPLPTPLDPEETAYPSLSGGNSTSNLTHTMTHLGISRGMGLGPGYDAPGLHSPLSHPSLQSSLSNP    281 - 350
NLQASLSSPQPQLQGSHSHPSLPASSLARHVLPTTSLGHPSLSAPALSSSSSSSSTSSPVLGAPSYPAST    351 - 420
PGASPHHRRVPLSPLSLLAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTSKLSTDQRLPPYPYSS    421 - 490
PSLVLPTQPHTPKSLQQPGLPSQSCSVQSSGGQPPGRQSHYGTPYPPGPSGHGQQSYHRPMSDFNLGNLE    491 - 560
QFSMESPSASLVLDPPGFSEGPGFLGGEGPMGGPQDPHTFNHQNLTHCSRHGSGPNIILTGDSSPGFSKE    561 - 630
IAAALAGVPGFEVSAAGLELGLGLEDELRMEPLGLEGLNMLSDPCALLPDPAVEESFRSDRLQ           631 - 693
//

Text Mined References (76)

PMID Year Title
26652733 2016 CRTC2 Is a Coactivator of GR and Couples GR and CREB in the Regulation of Hepatic Gluconeogenesis.
26438156 2015 A TORC2-Akt Feed-Forward Topology Underlies HER3 Resiliency in HER2-Amplified Cancers.
26432405 2015 PI3K-mTORC2 but not PI3K-mTORC1 regulates transcription of HIF2A/EPAS1 and vascularization in neuroblastoma.
26004186 2015 The CREB Coactivator CRTC2 Is a Lymphoma Tumor Suppressor that Preserves Genome Integrity through Transcription of DNA Mismatch Repair Genes.
25256670 2014 CRTC2 and PROM1 expression in non-small cell lung cancer: analysis by Western blot and immunohistochemistry.
24529027 2014 CRTC2 enhances HBV transcription and replication by inducing PGC1? expression.
24484648 2014 Identification and validation of PROM1 and CRTC2 mutations in lung cancer patients.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23671120 2013 PRMT5 modulates the metabolic response to fasting signals.
More...