Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.02
PubTator Score 0.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
non primary Sjogren syndrome sicca 891 1.5e-02

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.600 1.5e-02

AA Sequence

MYPAGPPAGPVPRRGRRPLPGPPAPAPAPVPAARPPPPAPGPRPRVAVKMAFRKAYSIKDKLQAIERVKG      1 - 70
GERQASVCRDFGVPGGTLRGWLKDEPKLRWFLEQLGGEVGTQRKKMRLANEEEIDRAVYAWFLALRQHGV     71 - 140
PLSGPLIQAQAEAFARQIYGPECTFKASHGWFWRWQKRHGISSQRFYGEAGPPAPSPAPGPPVKEEPALP    141 - 210
SGAGPLPDRAPAPPPPAEGGYGDEQIYSASVTGLYWKLLPEQAAPPGAGDPGAGGCGRRWRGDRVTVLLA    211 - 280
ANLTGSHKLKPLVIGRLPDPPSLRHHNQDKFPASYRYSPDAWLSRPLLRGWFFEEFVPGVKRYLRRSCLQ    281 - 350
QKAVLLVAHPPCPSPAASMPALDSEDAPVRCRPEPLGPPEELQTPDGAVRVLFLSKGSSRAHIPAPLEQG    351 - 420
VVAAFKQLYKRELLRLAVSCASGSPLDFMRSFMLKDMLYLAGLSWDLVQAGSIERCWLLGLRAAFEPRPG    421 - 490
EDSAGQPAQAEEAAEHSRVLSDLTHLAALAYKCLAPEEVAEWLHLDDDGGPPEGCREEVGPALPPAAPPA    491 - 560
PASLPSAMGGGEDEEEATDYGGTSVPTAGEAVRGLETALRWLENQDPREVGPLRLVQLRSLISMARRLGG    561 - 630
IGHTPAGPYDGV                                                              631 - 642
//

Text Mined References (6)

PMID Year Title