Property Summary

NCBI Gene PubMed Count 24
PubMed Score 24.98
PubTator Score 9.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Glaucoma, Primary Open Angle 8
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 3.0
Corneal disease 31 0.0 3.0
Disease Target Count Z-score Confidence
primary open angle glaucoma 16 3.778 1.9
Low tension glaucoma 7 3.153 1.6

Expression

  Differential Expression (33)

Disease log2 FC p
active Crohn's disease 1.074 1.7e-02
acute quadriplegic myopathy 1.402 2.9e-05
adult high grade glioma 1.600 1.0e-04
Amyotrophic lateral sclerosis 1.117 2.9e-05
astrocytoma 1.200 3.9e-14
Astrocytoma, Pilocytic 1.500 2.1e-07
atypical teratoid / rhabdoid tumor 1.800 1.7e-03
autosomal dominant Emery-Dreifuss muscul... 1.199 4.7e-03
Barrett's esophagus 1.600 2.5e-02
ependymoma 1.300 9.3e-03
esophageal adenocarcinoma 1.800 2.2e-02
Gaucher disease type 1 -1.200 4.6e-02
glioblastoma 1.500 6.8e-06
interstitial cystitis 1.100 6.8e-05
intraductal papillary-mucinous neoplasm ... 1.300 4.2e-02
juvenile dermatomyositis 1.133 8.8e-09
medulloblastoma, large-cell 1.300 2.6e-03
nasopharyngeal carcinoma 1.100 5.1e-03
non-small cell lung cancer 1.091 1.3e-10
oligodendroglioma 1.200 1.7e-09
osteosarcoma 2.759 8.7e-06
ovarian cancer -1.400 2.2e-05
pancreatic cancer 1.100 2.1e-02
pancreatic carcinoma 1.100 2.1e-02
pancreatic ductal adenocarcinoma liver m... -1.185 4.3e-02
periodontitis 1.100 8.8e-24
Pick disease 1.100 5.4e-03
primitive neuroectodermal tumor 1.300 8.4e-05
psoriasis -1.300 3.0e-09
sonic hedgehog group medulloblastoma 1.100 1.7e-03
subependymal giant cell astrocytoma 2.260 2.6e-03
tuberculosis -1.100 1.9e-03
ulcerative colitis 1.200 4.9e-05

Gene RIF (10)

AA Sequence

MYVTMMMTDQIPLELPPLLNGEVAMMPHLVNGDAAQQVILVQVNPGETFTIRAEDGTLQCIQGPAEVPMM      1 - 70
SPNGSIPPIHVPPGYISQVIEDSTGVRRVVVTPQSPECYPPSYPSAMSPTHHLPPYLTHHPHFIHNSHTA     71 - 140
YYPPVTGPGDMPPQFFPQHHLPHTIYGEQEIIPFYGMSTYITREDQYSKPPHKKLKDRQIDRQNRLNSPP    141 - 210
SSIYKSSCTTVYNGYGKGHSGGSGGGGSGSGPGIKKTERRARSSPKSNDSDLQEYELEVKRVQDILSGIE    211 - 280
KPQVSNIQARAVVLSWAPPVGLSCGPHSGLSFPYSYEVALSDKGRDGKYKIIYSGEELECNLKDLRPATD    281 - 350
YHVRVYAMYNSVKGSCSEPVSFTTHSCAPECPFPPKLAHRSKSSLTLQWKAPIDNGSKITNYLLEWDEGK    351 - 420
RNSGFRQCFFGSQKHCKLTKLCPAMGYTFRLAARNDIGTSGYSQEVVCYTLGNIPQMPSAPRLVRAGITW    421 - 490
VTLQWSKPEGCSPEEVITYTLEIQEDENDNLFHPKYTGEDLTCTVKNLKRSTQYKFRLTASNTEGKSCPS    491 - 560
EVLVCTTSPDRPGPPTRPLVKGPVTSHGFSVKWDPPKDNGGSEILKYLLEITDGNSEANQWEVAYSGSAT    561 - 630
EYTFTHLKPGTLYKLRACCISTGGHSQCSESLPVRTLSIAPGQCRPPRVLGRPKHKEVHLEWDVPASESG    631 - 700
CEVSEYSVEMTEPEDVASEVYHGPELECTVGNLLPGTVYRFRVRALNDGGYGPYSDVSEITTAAGPPGQC    701 - 770
KAPCISCTPDGCVLVGWESPDSSGADISEYRLEWGEDEESLELIYHGTDTRFEIRDLLPAAQYCCRLQAF    771 - 840
NQAGAGPYSELVLCQTPASAPDPVSTLCVLEEEPLDAYPDSPSACLVLNWEEPCNNGSEILAYTIDLGDT    841 - 910
SITVGNTTMHVMKDLLPETTYRIRIQAINEIGAGPFSQFIKAKTRPLPPLPPRLECAAAGPQSLKLKWGD    911 - 980
SNSKTHAAEDIVYTLQLEDRNKRFISIYRGPSHTYKVQRLTEFTCYSFRIQAASEAGEGPFSETYTFSTT    981 - 1050
KSVPPTIKAPRVTQLEGNSCEILWETVPSMKGDPVNYILQVLVGRESEYKQVYKGEEATFQISGLQTNTD   1051 - 1120
YRFRVCACRRCLDTSQELSGAFSPSAAFVLQRSEVMLTGDMGSLDDPKMKSMMPTDEQFAAIIVLGFATL   1121 - 1190
SILFAFILQYFLMK                                                           1191 - 1204
//

Text Mined References (31)

PMID Year Title