Property Summary

Ligand Count 3
NCBI Gene PubMed Count 200
PubMed Score 320.95
PubTator Score 271.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

 GO Function (1)

Gene RIF (177)

AA Sequence

MDVENEQILNVNPADPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKAKRRLRKNSSRD      1 - 70
SGRGDSVSDSGSDALRSGLTVPTSPKGRLLDRRSRSGKGRGLPKKGGAGGKGVWGTPGQVYDVEEVDVKD     71 - 140
PNYDDDQENCVYETVVLPLDERAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALE    141 - 210
GKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYID    211 - 280
SYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHC    281 - 350
LKELEVPHFHHELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVP    351 - 420
HSYSVLERFVEECFQAGIISKQLRDLCPSRGRKRFVSEGDGGRLKPESY                         421 - 469
//

Text Mined References (210)

PMID Year Title