Property Summary

NCBI Gene PubMed Count 182
Grant Count 48
R01 Count 21
Funding $3,849,695.32
PubMed Score 284.95
PubTator Score 271.04

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (161)

PMID Text
26961483 miR-183 maybe functions as an oncogene by regulating gastric cancer cell proliferation, apoptosis and metastasis and the oncogenic effect of miR-183 may relate the direct targeting PDCD4
26943153 PDGF-BB stimulates cell proliferation through microRNA-21-mediated PDCD4 down-regulation, leading to the development of TAO.
26871813 Results indicated that PDCD4 may be a novel candidate of tumor suppressor gene in hepatocellular carcinoma and that promoter hypermethylation is an important mechanism for its downregulation and a good predictor of survival.
26867589 This study describes the regulation of PDCD4 specifically in tonsil SCC by miR-499 and miR-21 and has documented the loss of PDCD4 in oropharyngeal squamous cell carcinoma
26802652 PDCD4 inhibits cell growth through PI3K/Akt signaling in non-small cell lung cancer.
26773498 We propose that SRSF3 could act as a coordinator of the expression of PDCD4 protein via two mechanisms on two alternatively spliced mRNA isoforms.
26367487 Dysregulation of miR-21 has an important role in tumor growth and invasion by targeting PDCD4.
26284486 miR-21 has a role in upregulating PTEN, RECK and PDCD4 in glioma
26276504 Low PDCD4 increases osteosarcoma cells resistance to apoptosis.
26252635 These findings support the feasibility of future efforts for diagnosis and gene therapy for prostate cancer that are based on IL-6, miR-21, and PDCD4.
More...

AA Sequence

MDVENEQILNVNPADPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKAKRRLRKNSSRD      1 - 70
SGRGDSVSDSGSDALRSGLTVPTSPKGRLLDRRSRSGKGRGLPKKGGAGGKGVWGTPGQVYDVEEVDVKD     71 - 140
PNYDDDQENCVYETVVLPLDERAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALE    141 - 210
GKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYID    211 - 280
SYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHC    281 - 350
LKELEVPHFHHELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVP    351 - 420
HSYSVLERFVEECFQAGIISKQLRDLCPSRGRKRFVSEGDGGRLKPESY                         421 - 469
//

Text Mined References (192)

PMID Year Title
26961483 2016 MicroRNA-183 Functions As an Oncogene by Regulating PDCD4 in Gastric Cancer.
26943153 2016 PDGF-BB Enhances the Proliferation of Cells in Human Orbital Fibroblasts by Suppressing PDCD4 Expression Via Up-Regulation of microRNA-21.
26871813 2016 Hypermethylation and Expression Silencing of PDCD4 Gene in Hepatocellular Carcinoma: A Consort Study.
26867589 2016 Regulation of the tumour suppressor PDCD4 by miR-499 and miR-21 in oropharyngeal cancers.
26802652 2016 Reduced PDCD4 Expression Promotes Cell Growth Through PI3K/Akt Signaling in Non-Small Cell Lung Cancer.
26773498 2016 SRSF3 represses the expression of PDCD4 protein by coordinated regulation of alternative splicing, export and translation.
26367487 2015 miR-21 regulates tumor progression through the miR-21-PDCD4-Stat3 pathway in human salivary adenoid cystic carcinoma.
26284486 2015 Exosomal levels of miRNA-21 from cerebrospinal fluids associated with poor prognosis and tumor recurrence of glioma patients.
26276504 2016 TGF-?1-induced miR-202 mediates drug resistance by inhibiting apoptosis in human osteosarcoma.
26252635 2015 IL-6 Inhibits the Targeted Modulation of PDCD4 by miR-21 in Prostate Cancer.
More...