Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.91
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Synonym

Accession Q538Z0 K7EQW5
Symbols MPD6
MTPNUT

Gene

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
16982933 A 6.4 kDa tumor antigen is produced from a cryptic ORF in the 3' UTR of the MTPN gene by using a novel internal ribosome entry site and non-AUG translation initiation.

AA Sequence

MKSVISYALYQVQTGSLPVYSSVLTKSPLQLQTVIYRLIVQIQHLNIPSSSSTHSSPF                  1 - 58
//

Text Mined References (2)

PMID Year Title
16982933 2006 An unconventional antigen translated by a novel internal ribosome entry site elicits antitumor humoral immune reactions.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.