Property Summary

NCBI Gene PubMed Count 2
PubMed Score 2.28
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Synonym

Accession Q538Z0 K7EQW5
Symbols MPD6
MTPNUT

Gene

 Compartment GO Term (1)

 HCA RNA Cell Line (3)

Gene RIF (1)

AA Sequence

MKSVISYALYQVQTGSLPVYSSVLTKSPLQLQTVIYRLIVQIQHLNIPSSSSTHSSPF                  1 - 58
//

Text Mined References (2)

PMID Year Title