Property Summary

NCBI Gene PubMed Count 2
Grant Count 4
R01 Count 4
Funding $1,158,729
PubMed Score 1.91
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Synonym

Accession Q538Z0 K7EQW5
Symbols MPD6
MTPNUT

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
16982933 A 6.4 kDa tumor antigen is produced from a cryptic ORF in the 3' UTR of the MTPN gene by using a novel internal ribosome entry site and non-AUG translation initiation.

AA Sequence

MKSVISYALYQVQTGSLPVYSSVLTKSPLQLQTVIYRLIVQIQHLNIPSSSSTHSSPF                  1 - 58
//

Text Mined References (2)

PMID Year Title
16982933 2006 An unconventional antigen translated by a novel internal ribosome entry site elicits antitumor humoral immune reactions.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.