Property Summary

NCBI Gene PubMed Count 4
Grant Count 2
Funding $487,500
PubMed Score 57.80
PubTator Score 5.17

Knowledge Summary

Patent (1,293)

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma 1.105 0.021
posterior fossa group B ependymoma -1.900 0.000
glioblastoma -1.400 0.014
non-small cell lung cancer 1.105 0.000
adult high grade glioma -1.300 0.006
group 4 medulloblastoma 1.500 0.000
pilocytic astrocytoma -1.400 0.000
subependymal giant cell astrocytoma -1.974 0.026
Breast cancer 1.200 0.000
ductal carcinoma in situ 1.700 0.001
invasive ductal carcinoma 1.900 0.001
pituitary cancer 1.100 0.000

Gene RIF (2)

PMID Text
21104019 Results suggest that the wide-spread expression pattern of human SBK1 may predict a broad cellular function, and its dysregulation in certain cancers suggests an involvement of the protein in the pathogenesis of human cancers.
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSVGCPEPEPPRSLTCCGPGTAPGPGAGVPLLTEDMQALTLRTLAASDVTKHYELVRELGKGTYGKVDLV      1 - 70
VYKGTGTKMALKFVNKSKTKLKNFLREVSITNSLSSSPFIIKVFDVVFETEDCYVFAQEYAPAGDLFDII     71 - 140
PPQVGLPEDTVKRCVQQLGLALDFMHGRQLVHRDIKPENVLLFDRECRRVKLADFGMTRRVGCRVKRVSG    141 - 210
TIPYTAPEVCQAGRADGLAVDTGVDVWAFGVLIFCVLTGNFPWEAASGADAFFEEFVRWQRGRLPGLPSQ    211 - 280
WRRFTEPALRMFQRLLALEPERRGPAKEVFRFLKHELTSELRRRPSHRARKPPGDRPPAAGPLRLEAPGP    281 - 350
LKRTVLTESGSGSRPAPPAVGSVPLPVPVPVPVPVPVPVPEPGLAPQGPPGRTDGRADKSKGQVVLATAI    351 - 420
EICV                                                                      421 - 424
//

Text Mined References (5)

PMID Year Title
21104019 2011 Human SBK1 is dysregulated in multiple cancers and promotes survival of ovary cancer SK-OV-3 cells.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
11322885 2001 Cloning and characterization of a novel serine/threonine protein kinase gene expressed predominantly in developing brain.