Property Summary

Ligand Count 2
NCBI Gene PubMed Count 4
PubMed Score 61.13
PubTator Score 5.17

Knowledge Summary

Patent (1,293)

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.300 6.2e-03
Astrocytoma, Pilocytic -1.400 2.9e-07
Breast cancer 1.100 5.4e-08
ductal carcinoma in situ 1.700 1.1e-03
ependymoma -1.700 5.9e-10
glioblastoma -1.100 1.3e-03
group 4 medulloblastoma 1.400 2.8e-04
invasive ductal carcinoma 1.500 8.5e-03
non-small cell lung cancer 1.105 3.9e-09
osteosarcoma 1.105 2.1e-02
pituitary cancer 1.100 2.5e-06
subependymal giant cell astrocytoma -1.974 2.6e-02

Gene RIF (2)

AA Sequence

MSVGCPEPEPPRSLTCCGPGTAPGPGAGVPLLTEDMQALTLRTLAASDVTKHYELVRELGKGTYGKVDLV      1 - 70
VYKGTGTKMALKFVNKSKTKLKNFLREVSITNSLSSSPFIIKVFDVVFETEDCYVFAQEYAPAGDLFDII     71 - 140
PPQVGLPEDTVKRCVQQLGLALDFMHGRQLVHRDIKPENVLLFDRECRRVKLADFGMTRRVGCRVKRVSG    141 - 210
TIPYTAPEVCQAGRADGLAVDTGVDVWAFGVLIFCVLTGNFPWEAASGADAFFEEFVRWQRGRLPGLPSQ    211 - 280
WRRFTEPALRMFQRLLALEPERRGPAKEVFRFLKHELTSELRRRPSHRARKPPGDRPPAAGPLRLEAPGP    281 - 350
LKRTVLTESGSGSRPAPPAVGSVPLPVPVPVPVPVPVPVPEPGLAPQGPPGRTDGRADKSKGQVVLATAI    351 - 420
EICV                                                                      421 - 424
//

Text Mined References (5)

PMID Year Title