Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 6.09145804909423E-15
medulloblastoma 1524 9.22476140097511E-8
medulloblastoma, large-cell 6234 3.138105835866E-6
adult high grade glioma 2148 1.00068585635675E-5
glioblastoma 5572 5.7973887146214E-4
atypical teratoid / rhabdoid tumor 4369 0.0122535919412262

Expression

  Differential Expression (6)

Disease log2 FC p
posterior fossa group A ependymoma -1.800 0.000
glioblastoma -1.500 0.001
medulloblastoma -2.600 0.000
atypical teratoid / rhabdoid tumor -1.200 0.012
medulloblastoma, large-cell -2.400 0.000
adult high grade glioma -1.600 0.000

Synonym

Accession Q52MB2 Q96MK5 Q96N39
Symbols C12orf68

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEDGLLEIMTKDGGDMPAPLEVSTVPAVGDVISGEYNGGMKELMEHLKAQLQALFEDVRAMRGALDEQAS      1 - 70
HIQVLSDDVCANQRAIVSMCQIMTTAPRQGGLGVVGGKGSFQSDPQEPETPSPGIGDSGLLGRDPEDEEE     71 - 140
EEEEKEMPSPATPSSHCERPESPCAGLLGGDGPLVEPLDMPDITLLQLEGEASL                    141 - 194
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16541075 2006 The finished DNA sequence of human chromosome 12.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.