Property Summary

NCBI Gene PubMed Count 19
PubMed Score 12.04
PubTator Score 5.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -1.100 4.5e-02
astrocytic glioma -1.500 3.6e-02
atypical teratoid / rhabdoid tumor -1.300 1.5e-02
Breast cancer -1.100 6.2e-06
dermatomyositis 1.200 7.6e-03
group 4 medulloblastoma -2.400 9.9e-05
interstitial cystitis 1.200 4.9e-05
intraductal papillary-mucinous carcinoma... -2.400 2.4e-02
juvenile dermatomyositis 1.231 9.2e-09
lung adenocarcinoma -1.300 2.9e-12
lung cancer -3.200 1.1e-05
lung carcinoma -1.800 2.5e-09
medulloblastoma, large-cell 1.100 3.4e-03
non primary Sjogren syndrome sicca -1.100 2.3e-02
non-small cell lung cancer -2.029 2.6e-16
oligodendroglioma -1.300 3.0e-02
ovarian cancer -1.400 6.0e-04
primitive neuroectodermal tumor -1.300 3.4e-03
Rheumatoid arthritis 1.800 4.7e-02
ulcerative colitis 2.300 5.1e-06

Gene RIF (8)

AA Sequence

MIAHKQKKTKKKRAWASGQLSTDITTSEMGLKSLSSNSIFDPDYIKELVNDIRKFSHMLLYLKEAIFSDC      1 - 70
FKEVIHIRLEELLRVLKSIMNKHQNLNSVDLQNAAEMLTAKVKAVNFTEVNEENKNDLFQEVFSSIETLA     71 - 140
FTFGNILTNFLMGDVGNDSLLRLPVSRETKSFENVSVESVDSSSEKGNFSPLELDNVLLKNTDSIELALS    141 - 210
YAKTWSKYTKNIVSWVEKKLNLELESTRNMVKLAEATRTNIGIQEFMPLQSLFTNALLNDIESSHLLQQT    211 - 280
IAALQANKFVQPLLGRKNEMEKQRKEIKELWKQEQNKMLEAENALKKAKLLCMQRQDEYEKAKSSMFRAE    281 - 350
EEHLSSSGGLAKNLNKQLEKKRRLEEEALQKVEEANELYKVCVTNVEERRNDLENTKREILAQLRTLVFQ    351 - 420
CDLTLKAVTVNLFHMQHLQAASLADSLQSLCDSAKLYDPGQEYSEFVKATNSTEEEKVDGNVNKHLNSSQ    421 - 490
PSGFGPANSLEDVVRLPDSSNKIEEDRCSNSADITGPSFIRSWTFGMFSDSESTGGSSESRSLDSESISP    491 - 560
GDFHRKLPRTPSSGTMSSADDLDEREPPSPSETGPNSLGTFKKTLMSKAALTHKFRKLRSPTKCRDCEGI    561 - 630
VVFQGVECEECLLVCHRKCLENLVIICGHQKLPGKIHLFGAEFTQVAKKEPDGIPFILKICASEIENRAL    631 - 700
CLQGIYRVCGNKIKTEKLCQALENGMHLVDISEFSSHDICDVLKLYLRQLPEPFILFRLYKEFIDLAKEI    701 - 770
QHVNEEQETKKNSLEDKKWPNMCIEINRILLKSKDLLRQLPASNFNSLHFLIVHLKRVVDHAEENKMNSK    771 - 840
NLGVIFGPSLIRPRPTTAPITISSLAEYSNQARLVEFLITYSQKIFDGSLQPQDVMCSIGVVDQGCFPKP    841 - 910
LLSPEERDIERSMKSLFFSSKEDIHTSESESKIFERATSFEESERKQNALGKCDACLSDKAQLLLDQEAE    911 - 980
SASQKIEDGKTPKPLSLKSDRSTNNVERHTPRTKIRPVSLPVDRLLLASPPNERNGRNMGNVNLDKFCKN    981 - 1050
PAFEGVNRKDAATTVCSKFNGFDQQTLQKIQDKQYEQNSLTAKTTMIMPSALQEKGVTTSLQISGDHSIN   1051 - 1120
ATQPSKPYAEPVRSVREASERRSSDSYPLAPVRAPRTLQPQHWTTFYKPHAPIISIRGNEEKPASPSAAV   1121 - 1190
PPGTDHDPHGLVVKSMPDPDKASACPGQATGQPKEDSEELGLPDVNPMCQRPRLKRMQQFEDLEGEIPQF   1191 - 1260
V//

Text Mined References (27)

PMID Year Title