Property Summary

NCBI Gene PubMed Count 18
PubMed Score 9.72
PubTator Score 5.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
non-small cell lung cancer 2798 2.58514834054672E-16
lung adenocarcinoma 2714 4.00036701706481E-15
lung carcinoma 2844 2.54504095297975E-9
juvenile dermatomyositis 1189 9.17832596354777E-9
ulcerative colitis 2087 5.09955740005035E-6
lung cancer 4473 1.14996244292666E-5
Breast cancer 3099 4.48565784157478E-5
interstitial cystitis 2299 4.94548104930863E-5
medulloblastoma, large-cell 6234 5.42062121584046E-5
group 4 medulloblastoma 1875 9.87581867923411E-5
ovarian cancer 8492 6.00420163808421E-4
primitive neuroectodermal tumor 3031 0.00342647453285052
dermatomyositis 967 0.00756965391875591
atypical teratoid / rhabdoid tumor 4369 0.0149884838384682
non primary Sjogren syndrome sicca 840 0.0226401702565599
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.024300948188238
oligodendroglioma 2849 0.0299201494072705
astrocytic glioma 2241 0.0364885671787838
adult high grade glioma 2148 0.0449550970952598
Rheumatoid Arthritis 1171 0.0468684557015675
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cleft Lip 91 5.016 2.5
Cleft palate 125 4.881 2.4

Expression

  Differential Expression (20)

Synonym

Accession Q52LW3 O15463 Q59H86 Q5VYZ0 Q6NVX2 Q8TBI6
Symbols PARG1

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (7)

PMID Text
25963656 Data indicate that through GTPase-activating proteins ArhGAP29 complex formation Rap1 GTP-binding protein spatially restricts Rho-mediated signaling, which is necessary for endothelial barrier potentiation.
25163644 Genetic variants in ARHGAP29 contribute to the development of nonsyndromic cleft lip with cleft palate.
24635173 We identified genetic variants in TGFB3 and ARHGAP29 associated with suboptimal healing outcome.
23798437 Rasip1-ArhGAP29 pathway also functions in Rap1-mediated regulation of endothelial junctions, which controls endothelial barrier function
23008150 ARHGAP29 is the etiologic gene for the cleft lip with or without cleft palate locus identified by genome-wide association on chromosome 1p22.
19911011 Observational study of gene-disease association. (HuGE Navigator)
17488656 PARG1 expression was substantially reduced & it displayed at least partial promoter methylation in all investigated mantle-cell lines & in 31 primary cases. PARG1 is a strong candidate tumor suppressor gene in MCL.

AA Sequence

MIAHKQKKTKKKRAWASGQLSTDITTSEMGLKSLSSNSIFDPDYIKELVNDIRKFSHMLLYLKEAIFSDC      1 - 70
FKEVIHIRLEELLRVLKSIMNKHQNLNSVDLQNAAEMLTAKVKAVNFTEVNEENKNDLFQEVFSSIETLA     71 - 140
FTFGNILTNFLMGDVGNDSLLRLPVSRETKSFENVSVESVDSSSEKGNFSPLELDNVLLKNTDSIELALS    141 - 210
YAKTWSKYTKNIVSWVEKKLNLELESTRNMVKLAEATRTNIGIQEFMPLQSLFTNALLNDIESSHLLQQT    211 - 280
IAALQANKFVQPLLGRKNEMEKQRKEIKELWKQEQNKMLEAENALKKAKLLCMQRQDEYEKAKSSMFRAE    281 - 350
EEHLSSSGGLAKNLNKQLEKKRRLEEEALQKVEEANELYKVCVTNVEERRNDLENTKREILAQLRTLVFQ    351 - 420
CDLTLKAVTVNLFHMQHLQAASLADSLQSLCDSAKLYDPGQEYSEFVKATNSTEEEKVDGNVNKHLNSSQ    421 - 490
PSGFGPANSLEDVVRLPDSSNKIEEDRCSNSADITGPSFIRSWTFGMFSDSESTGGSSESRSLDSESISP    491 - 560
GDFHRKLPRTPSSGTMSSADDLDEREPPSPSETGPNSLGTFKKTLMSKAALTHKFRKLRSPTKCRDCEGI    561 - 630
VVFQGVECEECLLVCHRKCLENLVIICGHQKLPGKIHLFGAEFTQVAKKEPDGIPFILKICASEIENRAL    631 - 700
CLQGIYRVCGNKIKTEKLCQALENGMHLVDISEFSSHDICDVLKLYLRQLPEPFILFRLYKEFIDLAKEI    701 - 770
QHVNEEQETKKNSLEDKKWPNMCIEINRILLKSKDLLRQLPASNFNSLHFLIVHLKRVVDHAEENKMNSK    771 - 840
NLGVIFGPSLIRPRPTTAPITISSLAEYSNQARLVEFLITYSQKIFDGSLQPQDVMCSIGVVDQGCFPKP    841 - 910
LLSPEERDIERSMKSLFFSSKEDIHTSESESKIFERATSFEESERKQNALGKCDACLSDKAQLLLDQEAE    911 - 980
SASQKIEDGKTPKPLSLKSDRSTNNVERHTPRTKIRPVSLPVDRLLLASPPNERNGRNMGNVNLDKFCKN    981 - 1050
PAFEGVNRKDAATTVCSKFNGFDQQTLQKIQDKQYEQNSLTAKTTMIMPSALQEKGVTTSLQISGDHSIN   1051 - 1120
ATQPSKPYAEPVRSVREASERRSSDSYPLAPVRAPRTLQPQHWTTFYKPHAPIISIRGNEEKPASPSAAV   1121 - 1190
PPGTDHDPHGLVVKSMPDPDKASACPGQATGQPKEDSEELGLPDVNPMCQRPRLKRMQQFEDLEGEIPQF   1191 - 1260
V//

Text Mined References (26)

PMID Year Title
25963656 2015 Rap1 Spatially Controls ArhGAP29 To Inhibit Rho Signaling during Endothelial Barrier Regulation.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25163644 2014 Further evidence suggesting a role for variation in ARHGAP29 variants in nonsyndromic cleft lip/palate.
24635173 Digital imaging analysis to assess scar phenotype.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23798437 2013 Rasip1 mediates Rap1 regulation of Rho in endothelial barrier function through ArhGAP29.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
23008150 2012 Expression and mutation analyses implicate ARHGAP29 as the etiologic gene for the cleft lip with or without cleft palate locus identified by genome-wide association on chromosome 1p22.
21502573 2011 Genetic predictors of fibrin D-dimer levels in healthy adults.
More...