Property Summary

NCBI Gene PubMed Count 10
Grant Count 3
R01 Count 2
Funding $526,474
PubMed Score 15.92
PubTator Score 9.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
tuberculosis -1.100 0.000
ovarian cancer -1.100 0.000

Gene RIF (3)

PMID Text
24166297 EPC1 and EPC2 are components of a complex that directly or indirectly serves to prevent MYC accumulation and AML cell apoptosis, thus sustaining oncogenic potential
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18330920 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSKLSFRARALDAAKPLPIYRGKDMPDLNDCVSINRAVPQMPTGMEKEEESEHHLQRAISAQQVFREKKE      1 - 70
SMVIPVPEAESNVNYYNRLYKGEFKQPKQFIHIQPFNLDNEQPDYDMDSEDETLLNRLNRKMEIKPLQFE     71 - 140
IMIDRLEKASSNQLVTLQEAKLLLNEDDYLIKAVYDYWVRKRKNCRGPSLIPQIKQEKRDGSTNNDPYVA    141 - 210
FRRRTEKMQTRKNRKNDEASYEKMLKLRREFSRAITILEMIKRREKTKRELLHLTLEVVEKRYHLGDYGG    211 - 280
EILNEVKISRSEKELYATPATLHNGNHHKVQECKTKHPHHLSLKEEASDVVRQKKKYPKKPKAEALITSQ    281 - 350
QPTPETLPVINKSDIKQYDFHSSDEDEFPQVLSPVSEPEEENDPDGPCAFRRRAGCQYYAPRLDQANHSC    351 - 420
ENSELADLDKLRYRHCLTTLTVPRRCIGFARRRIGRGGRVIMDRISTEHDPVLKQIDPEMLNSFSSSSQT    421 - 490
IDFSSNFSRTNASSKHCENRLSLSEILSNIRSCRLQCFQPRLLNLQDSDSEECTSRKPGQTVNNKRVSAA    491 - 560
SVALLNTSKNGISVTGGITEEQFQTHQQQLVQMQRQQLAQLQQKQQSQHSSQQTHPKAQGSSTSDCMSKT    561 - 630
LDSASAHFAASAVVSAPVPSRSEVAKEQNTGHNNINGVVQPSGTSKTLYSTNMALSSSPGISAVQLVRTV    631 - 700
GHTTTNHLIPALCTSSPQTLPMNNSCLTNAVHLNNVSVVSPVNVHINTRTSAPSPTALKLATVAASMDRV    701 - 770
PKVTPSSAISSIARENHEPERLGLNGIAETTVAMEVT                                     771 - 807
//

Text Mined References (15)

PMID Year Title
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24166297 2014 Enhancers of Polycomb EPC1 and EPC2 sustain the oncogenic potential of MLL leukemia stem cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21123754 2011 Genome-wide association study of CSF biomarkers Abeta1-42, t-tau, and p-tau181p in the ADNI cohort.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
18330920 2008 Discovery of genetic profiles impacting response to chemotherapy: application to gemcitabine.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...