Property Summary

NCBI Gene PubMed Count 10
PubMed Score 17.48
PubTator Score 9.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
tuberculosis 2010 2.6e-05
ovarian cancer 8520 1.6e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer -1.100 1.6e-04
tuberculosis -1.100 2.6e-05

Protein-protein Interaction (12)

Gene RIF (3)

AA Sequence

MSKLSFRARALDAAKPLPIYRGKDMPDLNDCVSINRAVPQMPTGMEKEEESEHHLQRAISAQQVFREKKE      1 - 70
SMVIPVPEAESNVNYYNRLYKGEFKQPKQFIHIQPFNLDNEQPDYDMDSEDETLLNRLNRKMEIKPLQFE     71 - 140
IMIDRLEKASSNQLVTLQEAKLLLNEDDYLIKAVYDYWVRKRKNCRGPSLIPQIKQEKRDGSTNNDPYVA    141 - 210
FRRRTEKMQTRKNRKNDEASYEKMLKLRREFSRAITILEMIKRREKTKRELLHLTLEVVEKRYHLGDYGG    211 - 280
EILNEVKISRSEKELYATPATLHNGNHHKVQECKTKHPHHLSLKEEASDVVRQKKKYPKKPKAEALITSQ    281 - 350
QPTPETLPVINKSDIKQYDFHSSDEDEFPQVLSPVSEPEEENDPDGPCAFRRRAGCQYYAPRLDQANHSC    351 - 420
ENSELADLDKLRYRHCLTTLTVPRRCIGFARRRIGRGGRVIMDRISTEHDPVLKQIDPEMLNSFSSSSQT    421 - 490
IDFSSNFSRTNASSKHCENRLSLSEILSNIRSCRLQCFQPRLLNLQDSDSEECTSRKPGQTVNNKRVSAA    491 - 560
SVALLNTSKNGISVTGGITEEQFQTHQQQLVQMQRQQLAQLQQKQQSQHSSQQTHPKAQGSSTSDCMSKT    561 - 630
LDSASAHFAASAVVSAPVPSRSEVAKEQNTGHNNINGVVQPSGTSKTLYSTNMALSSSPGISAVQLVRTV    631 - 700
GHTTTNHLIPALCTSSPQTLPMNNSCLTNAVHLNNVSVVSPVNVHINTRTSAPSPTALKLATVAASMDRV    701 - 770
PKVTPSSAISSIARENHEPERLGLNGIAETTVAMEVT                                     771 - 807
//

Text Mined References (16)

PMID Year Title