Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.71
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Lupus Erythematosus, Systemic 73
Disease Target Count P-value
acute quadriplegic myopathy 1157 1.85921885834082E-6
hepatocellular carcinoma 550 1.21072856878063E-5
ovarian cancer 8492 4.9731294035684E-4
Pick disease 1893 0.0013940271240325
pancreatic cancer 2300 0.00573228281158235
pancreatic carcinoma 567 0.0057322828115824
gastric cancer 436 0.00823592405065411
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0232679294452598

Expression

  Differential Expression (8)

Disease log2 FC p
gastric cancer 1.300 0.008
hepatocellular carcinoma 1.500 0.000
pancreatic cancer 1.500 0.006
acute quadriplegic myopathy 1.142 0.000
intraductal papillary-mucinous carcinoma... 1.100 0.023
pancreatic carcinoma 1.500 0.006
Pick disease 1.100 0.001
ovarian cancer -1.700 0.000

Synonym

Accession Q52LJ0 A8MUW5 Q8N935
Symbols

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Fruitfly EggNOG Inparanoid

Gene RIF (2)

PMID Text
24608264 hCLE/C14orf166 associates with DDX1, HSPC117, and FAM98B in a novel transcription-dependent shuttling RNA-transporting complex.
22174317 HIV-1 Rev interacting protein, family with sequence similarity 98, member B (FAM98B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with FAM98B is increased by RRE

AA Sequence

MRGPEPGPQPTMEGDVLDTLEALGYKGPLLEEQALTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESIT      1 - 70
SAGRDDLESFQLEISGFLKEMACPYSVLISGDIKDRLKKKEDCLKLLLFLSTELQASQILQNKKHKNSQL     71 - 140
DKNSEVYQEVQAMFDTLGIPKSTTSDIPHMLNQVESKVKDILSKVQKNHVGKPLLKMDLNSEQAEQLERI    141 - 210
NDALSCEYECRRRMLMKRLDVTVQSFGWSDRAKVKTDDIARIYQPKRYALSPKTTITMAHLLAAREDLSK    211 - 280
IIRTSSGTSREKTACAINKVGVSFSTVENELMISYLMFLQILVYFSFMSW                        281 - 330
//

Text Mined References (15)

PMID Year Title
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24870230 2014 Analysis of orthologous groups reveals archease and DDX1 as tRNA splicing factors.
24608264 2014 hCLE/C14orf166 associates with DDX1-HSPC117-FAM98B in a novel transcription-dependent shuttling RNA-transporting complex.
24132900 2013 Genome-wide association study of atypical psychosis.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21311021 2011 HSPC117 is the essential subunit of a human tRNA splicing ligase complex.
21269460 2011 Initial characterization of the human central proteome.
17567985 2007 Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
More...