Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.42
PubTator Score 0.38

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MDKEKLDVKIEYCNYAMDSSVENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNN      1 - 70
CSISEEDFPEESQLHQCGFKIVYSQLPLGSLVLVKLQNWPSWPGILCPDRFKGKYVTYDPDGNVEEYHIE     71 - 140
FLGDPHSRSWIKATFVGHYSITLKPEKCKNKKKWYKSALQEACLLYGYSHEQRLEMCCLSKLQDKSETHD    141 - 210
KVAALVKKRKQTSKNNIEKKKPKFRKRKRKAILKCSFENVYSDDALSKENRVVCETEVLLKELEQMLQQA    211 - 280
LQPTATPDESEEGHGEEINMGEKLSKCSPEAPAGSLFENHYEEDYLVIDGIKLKAGECIEDITNKFKEID    281 - 350
ALMSEF                                                                    351 - 356
//

Text Mined References (5)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14607086 2003 The CW domain, a structural module shared amongst vertebrates, vertebrate-infecting parasites and higher plants.
12600744 2003 Molecular characterization of a human monoclonal antibody to B antigen in ABO blood type.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.