Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.42
PubTator Score 0.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

Synonym

Accession Q504Y3
Symbols ZCW2

Gene

PDB

4O62   4Z0O   4Z0R  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

AA Sequence

MDKEKLDVKIEYCNYAMDSSVENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNN      1 - 70
CSISEEDFPEESQLHQCGFKIVYSQLPLGSLVLVKLQNWPSWPGILCPDRFKGKYVTYDPDGNVEEYHIE     71 - 140
FLGDPHSRSWIKATFVGHYSITLKPEKCKNKKKWYKSALQEACLLYGYSHEQRLEMCCLSKLQDKSETHD    141 - 210
KVAALVKKRKQTSKNNIEKKKPKFRKRKRKAILKCSFENVYSDDALSKENRVVCETEVLLKELEQMLQQA    211 - 280
LQPTATPDESEEGHGEEINMGEKLSKCSPEAPAGSLFENHYEEDYLVIDGIKLKAGECIEDITNKFKEID    281 - 350
ALMSEF                                                                    351 - 356
//

Text Mined References (5)

PMID Year Title