Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.42
PubTator Score 0.38

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q504Y3
Symbols ZCW2

Gene

PDB

4O62   4Z0O   4Z0R  

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid

 GO Function (1)

AA Sequence

MDKEKLDVKIEYCNYAMDSSVENMYVNKVWVQCENENCLKWRLLSSEDSAKVDHDEPWYCFMNTDSRYNN      1 - 70
CSISEEDFPEESQLHQCGFKIVYSQLPLGSLVLVKLQNWPSWPGILCPDRFKGKYVTYDPDGNVEEYHIE     71 - 140
FLGDPHSRSWIKATFVGHYSITLKPEKCKNKKKWYKSALQEACLLYGYSHEQRLEMCCLSKLQDKSETHD    141 - 210
KVAALVKKRKQTSKNNIEKKKPKFRKRKRKAILKCSFENVYSDDALSKENRVVCETEVLLKELEQMLQQA    211 - 280
LQPTATPDESEEGHGEEINMGEKLSKCSPEAPAGSLFENHYEEDYLVIDGIKLKAGECIEDITNKFKEID    281 - 350
ALMSEF                                                                    351 - 356
//

Text Mined References (5)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14607086 2003 The CW domain, a structural module shared amongst vertebrates, vertebrate-infecting parasites and higher plants.
12600744 2003 Molecular characterization of a human monoclonal antibody to B antigen in ABO blood type.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.