Property Summary

NCBI Gene PubMed Count 15
Grant Count 2
R01 Count 2
Funding $946,668
PubMed Score 14.33
PubTator Score 3.61

Knowledge Summary

Patent (3,622)

Expression

Synonym

Accession Q504Y2 D6W5A0 Q96I09
Symbols Vlk
SGK493

Gene

 Grant Application (2)

Gene RIF (5)

PMID Text
25862977 The Fam20C-and VLK-family of kinases mediate the phosphorylation of proteins in the secretory pathway and extracellular space.Mutation in several secretory pathway kinases cause human disease
25171405 VLK is rapidly and quantitatively secreted from platelets in response to stimuli and can tyrosine phosphorylate coreleased proteins utilizing endogenous as well as exogenous ATP sources.
24407380 our results suggest that genes CA10 and also SGK493 may be an important risk factor for asthma development, especially for a nonatopic phenotype.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19961619 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MRRRRAAVAAGFCASFLLGSVLNVLFAPGSEPPRPGQSPEPSPAPGPGRRGGRGELARQIRARYEEVQRY      1 - 70
SRGGPGPGAGRPERRRLMDLAPGGPGLPRPRPPWARPLSDGAPGWPPAPGPGSPGPGPRLGCAALRNVSG     71 - 140
AQYMGSGYTKAVYRVRLPGGAAVALKAVDFSGHDLGSCVREFGVRRGCYRLAAHKLLKEMVLLERLRHPN    141 - 210
VLQLYGYCYQDSEDIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFR    211 - 280
PRQFVLVDGELKVTDLDDARVEETPCAGSTDCILEFPARNFTLPCSAQGWCEGMNEKRNLYNAYRFFFTY    281 - 350
LLPHSAPPSLRPLLDSIVNATGELAWGVDETLAQLEKVLHLYRSGQYLQNSTASSSTEYQCIPDSTIPQE    351 - 420
DYRCWPSYHHGSCLLSVFNLAEAVDVCESHAQCRAFVVTNQTTWTGRQLVFFKTGWSQVVPDPNKTTYVK    421 - 490
ASG                                                                       491 - 493
//

Text Mined References (16)

PMID Year Title
25862977 2015 The secretory pathway kinases.
25171405 2014 A secreted tyrosine kinase acts in the extracellular environment.
25108383 2014 Genome-wide association analyses identify variants in developmental genes associated with hypospadias.
24407380 2014 Polymorphisms in recent GWA identified asthma genes CA10, SGK493, and CTNNA3 are associated with disease severity and treatment response in childhood asthma.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19961619 2009 A pooling-based genome-wide analysis identifies new potential candidate genes for atopy in the European Community Respiratory Health Survey (ECRHS).
19465597 2009 The novel protein kinase Vlk is essential for stromal function of mesenchymal cells.
19097194 2009 Short limbs, cleft palate, and delayed formation of flat proliferative chondrocytes in mice with targeted disruption of a putative protein kinase gene, Pkdcc (AW548124).
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...