Property Summary

NCBI Gene PubMed Count 10
PubMed Score 6.76
PubTator Score 4.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -2.400 0.011
glioblastoma -3.600 0.000
oligodendroglioma -2.400 0.000
ependymoma -2.100 0.001
sonic hedgehog group medulloblastoma -4.900 0.000
atypical teratoid / rhabdoid tumor -4.500 0.000
medulloblastoma, large-cell -5.000 0.000
primitive neuroectodermal tumor -4.400 0.000
pediatric high grade glioma -3.400 0.000
pilocytic astrocytoma -2.500 0.000
pituitary cancer -1.700 0.000

Synonym

Accession Q504Y0 B7Z2Y9 B7ZL35 C9JJL4 F5GX72 Q49AN8 Q4G0L3 Q5VWV8 Q5VWV9 Q6NZY5 Q96NN4
Symbols ZIP-12
LZT-Hs8
bA570F3.1

Gene

PANTHER Protein Class (1)

Gene RIF (5)

PMID Text
23716681 Data indicate that the zinc transporter ZIP12 (slc39a12) is highly expressed in brain.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)
16311021 Examination of the zinc transporter gene, SLC39A12.

AA Sequence

MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVLSAGDHPPHNHSRSLIKTLLE      1 - 70
KTGCPRRRNGMQGDCNLCFEPDALLLIAGGNFEDQLREEVVQRVSLLLLYYIIHQEEICSSKLNMSNKEY     71 - 140
KFYLHSLLSLRQDEDSSFLSQNETEDILAFTRQYFDTSQSQCMETKTLQKKSGIVSSEGANESTLPQLAA    141 - 210
MIITLSLQGVCLGQGNLPSPDYFTEYIFSSLNRTNTLRLSELDQLLNTLWTRSTCIKNEKIHQFQRKQNN    211 - 280
IITHDQDYSNFSSSMEKESEDGPVSWDQTCFSARQLVEIFLQKGLSLISKEDFKQMSPGIIQQLLSCSCH    281 - 350
LPKDQQAKLPPTTLEKYGYSTVAVTLLTLGSMLGTALVLFHSCEENYRLILQLFVGLAVGTLSGDALLHL    351 - 420
IPQVLGLHKQEAPEFGHFHESKGHIWKLMGLIGGIHGFFLIEKCFILLVSPNDKQGLSLVNGHVGHSHHL    421 - 490
ALNSELSDQAGRGKSASTIQLKSPEDSQAAEMPIGSMTASNRKCKAISLLAIMILVGDSLHNFADGLAIG    491 - 560
AAFSSSSESGVTTTIAILCHEIPHEMGDFAVLLSSGLSMKTAILMNFISSLTAFMGLYIGLSVSADPCVQ    561 - 630
DWIFTVTAGMFLYLSLVEMLPEMTHVQTQRPWMMFLLQNFGLILGWLSLLLLAIYEQNIKI             631 - 691
//

Text Mined References (15)

PMID Year Title
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
23716681 2013 Neurulation and neurite extension require the zinc transporter ZIP12 (slc39a12).
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16311021 2006 Examination of the zinc transporter gene, SLC39A12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
More...