Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Synonym

Accession Q504U0 B3KNH7
Symbols RCDG1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MADPEELQVSSPPPPPPSSPSSSDASAASSPGGPVSLGWPVPSRSSGPTVDQLEEVELQIGDAAFSLTKL      1 - 70
LEATSAVSAQVEELAFKCTENARFLKTWRDLLKEGYDSLKPDD                                71 - 113
//

Text Mined References (8)

PMID Year Title