Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
25059753 A reduction in RCDG1 expression may be associated with the oncogenesis of renal cell carcinoma and the differentiation of clear cell renal cell carcinoma.

AA Sequence

MADPEELQVSSPPPPPPSSPSSSDASAASSPGGPVSLGWPVPSRSSGPTVDQLEEVELQIGDAAFSLTKL      1 - 70
LEATSAVSAQVEELAFKCTENARFLKTWRDLLKEGYDSLKPDD                                71 - 113
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25059753 2014 Expression and clinical significance of RCDG1 in renal cell carcinoma: a novel renal cancer?associated gene.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.