Property Summary

NCBI Gene PubMed Count 5
PubMed Score 13.08
PubTator Score 4.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
glioblastoma multiforme 347 6.91570447374062E-16
astrocytoma 1493 7.23709900505212E-16
oligodendroglioma 2849 2.67673137866953E-12
non-small cell lung cancer 2798 8.6574458846046E-11
osteosarcoma 7933 5.09646912337309E-4
primitive neuroectodermal tumor 3031 0.00289136842064576
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00439185191954087
primary pancreatic ductal adenocarcinoma 1271 0.00688762331977263
Rheumatoid Arthritis 1171 0.0150222406181815
interstitial lung disease 292 0.0198160603148981
diabetes mellitus 1663 0.0206280655953892
group 3 medulloblastoma 2254 0.022641663664145
gastric carcinoma 832 0.0478370370779971
Disease Target Count Z-score Confidence
Peutz-Jeghers syndrome 23 3.545 1.8

Expression

Synonym

Accession Q504T8 Q96BW8
Symbols

Gene

  Ortholog (11)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (1)

PMID Text
24187134 midnolin plays a role in cellular signaling of adult tissues and regulates glucokinase enzyme activity in pancreatic beta cells

AA Sequence

MEPQPGGARSCRRGAPGGACELGPAAEAAPMSLAIHSTTGTRYDLAVPPDETVEGLRKRLSQRLKVPKER      1 - 70
LALLHKDTRLSSGKLQEFGVGDGSKLTLVPTVEAGLMSQASRPEQSVMQALESLTETQVSDFLSGRSPLT     71 - 140
LALRVGDHMMFVQLQLAAQHAPLQHRHVLAAAAAAAAARGDPSIASPVSSPCRPVSSAARVPPVPTSPSP    141 - 210
ASPSPITAGSFRSHAASTTCPEQMDCSPTASSSASPGASTTSTPGASPAPRSRKPGAVIESFVNHAPGVF    211 - 280
SGTFSGTLHPNCQDSSGRPRRDIGTILQILNDLLSATRHYQGMPPSLAQLRCHAQCSPASPAPDLAPRTT    281 - 350
SCEKLTAAPSASLLQGQSQIRMCKPPGDRLRQTENRATRCKVERLQLLLQQKRLRRKARRDARGPYHWSP    351 - 420
SRKAGRSDSSSSGGGGSPSEASGLGLDFEDSVWKPEVNPDIKSEFVVA                          421 - 468
//

Text Mined References (6)

PMID Year Title
24187134 2013 Identification of the ubiquitin-like domain of midnolin as a new glucokinase interaction partner.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11441184 2001 Human chromosome 19 and related regions in mouse: conservative and lineage-specific evolution.
10974535 2000 Novel nucleolar protein, midnolin, is expressed in the mesencephalon during mouse development.