Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.75
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Spinocerebellar Ataxias 34 0.0 0.0
Disease Target Count P-value
nasopharyngeal carcinoma 1058 4.1e-07
lung carcinoma 2843 8.3e-04
ependymoma 4679 3.7e-02
chronic rhinosinusitis 512 3.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 4.0
Neurodegenerative disease 414 0.0 4.0
Disease Target Count Z-score Confidence
Cerebellar Ataxia 304 3.38 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
chronic rhinosinusitis -1.364 3.8e-02
ependymoma 1.900 3.7e-02
lung carcinoma -1.400 8.3e-04
nasopharyngeal carcinoma -2.000 4.1e-07

Gene RIF (2)

AA Sequence

MEKSGPSSTISEQQLQRQEGWINTKTDLAEQSLISSEKWLQLHGLKSNKLTLKQILSQIGFPHCEDYVAS      1 - 70
LGRPVASRYADGLFPQLYRAEDGRVYNLTAKSELIYQFVEHLTQAVESYKQRMDWLTSKSRQIFGVILEQ     71 - 140
CVTIVLDFGGILEGELDLCREALTMVLQEQVAHITEFNIIRVSQEPVKWQENATPVTEQSIATAISWVEK    141 - 210
LTVELTVSEAGRLDALLEAGRDKTIESIYYFVVGDVPEESKELLLQRALEIPCPVYTVSFNARGEGTIAF    211 - 280
LKDLSAKTHSRFHAFAERTECVEFPAFSTKDGDNVMTWNSRKLKGKLPPGAGVREDVFLVWQEMEEACST    281 - 350
LAQIQRLVAEPPKPDVATVDCESETTSVEIASNPEDTWDSKTWLQKYGLKAQKLSLYDVLADCSFRHADG    351 - 420
VVDIKAKPENESVQTSAETNKKTVHAKYCSRFVHAPWKDGSLVHVNITKEKCKWYSERIHTALARIRRRI    421 - 490
KWLQDGSQSLFGRLHNDCIYILIDTSHSMKSKLDLVKDKIIQFIQEQLKYKSKFNFVKFDGQAVAWREQL    491 - 560
AEVNEDNLEQAQSWIRDIKIGSSTNTLSALKTAFADKETQAIYLLTDGRPDQPPETVIDQVKRFQEIPIY    561 - 630
TISFNYNDEIANRFLKEVAALTGGEFHFYNFGCKDPTPPEAVQNEDLTLLVKEMEQGHSDLEKMQDLYSE    631 - 700
SLIMDWWYNAEKDGDSKHQKEICSMISTPEKCAKPQSDVDSTQTSSLNMLKGPWGLSDQKVQKKKVLHAE    701 - 770
STKTSLLRSQMSSLRSSACSERKDGLSNASSRRTALSDKEMSILLAEEWLDDKSSEKVTREGSQVYDHDS    771 - 840
SDVSSENWLKTYGLVAKKLTLMDALSVAAVPHSSTYVPVLDKHVVSKVFDEVFPLAHVCNDTNKMTLINP    841 - 910
QGAKLNIYKRKVEQAIQSYEKRLNKIVWRALSQEEKEKLDANKPIQYLENKTVLNQALERLNWPISLKEL    911 - 980
SMLESEILAGKMYIQQAMELQEAAKKNYANKAPGEQQKLQGNPTKKTKSKRPDPLKGQKVIARCDENGFY    981 - 1050
FPGVVKKCVSRTQALVGFSYGDTKVVSTSFITPVGGAMPCPLLQVGDYVFAKIVIPKGFDFYVPAIVIAL   1051 - 1120
PNKHVATEKFYTVLKCNNRREFCPRSALIKISQNKYALSCSHIKSPPIPEDPEVEDVEARNSAFLFWPLK   1121 - 1190
EADTQDSREPRREKPRRKKRPAKQPLQQAAPSDSDGSSHGISSHGSCQGTHPEPRTAHLHFPAAGRLGLS   1191 - 1260
SHAIIATPPPRAALPCTLQATHSSKGLRSVPETL                                       1261 - 1294
//

Text Mined References (10)

PMID Year Title