Property Summary

NCBI Gene PubMed Count 3
PubMed Score 75.80
PubTator Score 15.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.880 0.000

Synonym

Accession Q4ZJI4 A1KXV1 B9EH04 C9JBP7 Q49A30 Q8NCV2 Q8WVZ0
Symbols NHA1
NHEDC1

Gene

Gene RIF (3)

PMID Text
25701605 Results identified multiple cis-acting DNA regulatory elements in the 5 end of the SLC9B1 gene and shown that DNA methylation at these elements could provide mechanisms by which SLC9B1 expression is restricted to male germ cells.
19460752 Knockdown of solute carrier family 9, subfamily B (cation proton antiporter 2), member 1 (SLC9B1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
16850186 cloning and characterization of a novel NHEDC1 (Na+/H+ exchanger like domain containing 1) gene; it was mapped to chromosome 4p24; molecular weight of NHEDC1 is about 56 KDa; it is exclusively expressed in the testis

AA Sequence

MHTTESKNEHLEDENFQTSTTPQSLIDPNNTAQEETKTVLSDTEEIKPQTKKETYISCPLRGVLNVIITN      1 - 70
GVILFVIWCMTWSILGSEALPGGNLFGLFIIFYSAIIGGKILQLIRIPLVPPLPPLLGMLLAGFTIRNVP     71 - 140
FINEHVHVPNTWSSILRSIALTIILIRAGLGLDPQALRHLKVVCFRLAVGPCLMEASAAAVFSHFIMKFP    141 - 210
WQWAFLLGFVLGAVSPAVVVPYMMVLQENGYGVEEGIPTLLMAASSMDDILAITGFNTCLSIVFSSGGIL    211 - 280
NNAIASIRNVCISLLAGIVLGFFVRYFPSEDQKKLTLKRGFLVLTMCVSAVLGSQRIGLHGSGGLCTLVL    281 - 350
SFIAGTKWSQEKMKVQKIITTVWDIFQPLLFGLVGAEVSVSSLESNIVGISVATLSLALCVRILTTYLLM    351 - 420
CFAGFSFKEKIFIALAWMPKATVQAVLGPLALETARVSAPHLEPYAKDVMTVAFLAILITAPNGALLMGI    421 - 490
LGPKMLTRHYDPSKIKLQLSTLEHH                                                 491 - 515
//

Text Mined References (5)

PMID Year Title
25701605 2015 Identification and characterization of methylation-dependent/independent DNA regulatory elements in the human SLC9B1 gene.
16850186 2006 Cloning of a novel human NHEDC1 (Na+/H+ exchanger like domain containing 1) gene expressed specifically in testis.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.