Property Summary

NCBI Gene PubMed Count 6
PubMed Score 19.99
PubTator Score 13.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma 1.105 2.2e-03
astrocytic glioma 1.800 1.0e-02
atypical teratoid / rhabdoid tumor 1.100 9.6e-03
breast carcinoma 1.600 2.1e-02
COPD -1.300 1.1e-02
ependymoma 2.400 9.0e-04
Gaucher disease type 1 -1.200 1.8e-02
glioblastoma 1.100 2.1e-02
group 4 medulloblastoma 1.300 8.6e-03
medulloblastoma, large-cell 1.100 5.3e-04
oligodendroglioma 2.400 5.8e-04
osteosarcoma 1.639 1.8e-03
ovarian cancer 1.100 7.4e-06
Pick disease -1.200 7.1e-05
progressive supranuclear palsy -1.100 1.2e-02
subependymal giant cell astrocytoma -1.160 4.0e-02
tuberculosis and treatment for 6 months -1.200 7.5e-05

Gene RIF (2)

AA Sequence

MSEHVEPAAPGPGPNGGGGGPAPARGPRTPNLNPNPLINVRDRLFHALFFKMAVTYSRLFPPAFRRLFEF      1 - 70
FVLLKALFVLFVLAYIHIVFSRSPINCLEHVRDKWPREGILRVEVRHNSSRAPVFLQFCDSGGRGSFPGL     71 - 140
AVEPGSNLDMEDEEEEELTMEMFGNSSIKFELDIEPKVFKPPSSTEALNDSQEFPFPETPTKVWPQDEYI    141 - 210
VEYSLEYGFLRLSQATRQRLSIPVMVVTLDPTRDQCFGDRFSRLLLDEFLGYDDILMSSVKGLAENEENK    211 - 280
GFLRNVVSGEHYRFVSMWMARTSYLAAFAIMVIFTLSVSMLLRYSHHQIFVFIVDLLQMLEMNMAIAFPA    281 - 350
APLLTVILALVGMEAIMSEFFNDTTTAFYIILIVWLADQYDAICCHTSTSKRHWLRFFYLYHFAFYAYHY    351 - 420
RFNGQYSSLALVTSWLFIQHSMIYFFHHYELPAILQQVRIQEMLLQAPPLGPGTPTALPDDMNNNSGAPA    421 - 490
TAPDSAGQPPALGPVSPGASGSPGPVAAAPSSLVAAAASVAAAAGGDLGWMAETAAIITDASFLSGLSAS    491 - 560
LLERRPASPLGPAGGLPHAPQDSVPPSDSAASDTTPLGAAVGGPSPASMAPTEAPSEVGS              561 - 620
//

Text Mined References (10)

PMID Year Title