Property Summary

NCBI Gene PubMed Count 6
Grant Count 1
Funding $852,265
PubMed Score 17.88
PubTator Score 13.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma 1.800 0.010
ependymoma 2.400 0.001
oligodendroglioma 2.400 0.001
osteosarcoma 1.681 0.003
group 4 medulloblastoma 1.500 0.018
atypical teratoid / rhabdoid tumor 1.100 0.010
glioblastoma 1.100 0.021
medulloblastoma, large-cell 1.200 0.001
adrenocortical carcinoma 1.207 0.003
tuberculosis and treatment for 6 months -1.200 0.000
breast carcinoma 1.600 0.021
subependymal giant cell astrocytoma -1.160 0.040
COPD -1.500 0.009
Pick disease -1.300 0.000
progressive supranuclear palsy -1.100 0.012
ovarian cancer 1.100 0.000
Gaucher disease type 1 -1.200 0.018

Synonym

Accession Q4ZIN3 O60392 Q8NF79 Q96H30
Symbols MBRL
ASBABP1
C19orf6
R32184_3
MEMBRALIN

Gene

PANTHER Protein Class (1)

 Grant Application (1)

Gene RIF (2)

PMID Text
16084606 Study provides first characterization of human membralin and suggests that membralin is a novel tumor-associated marker in ovarian serous carcinomas.
12638133 genomic organization and expression (membralin)

AA Sequence

MSEHVEPAAPGPGPNGGGGGPAPARGPRTPNLNPNPLINVRDRLFHALFFKMAVTYSRLFPPAFRRLFEF      1 - 70
FVLLKALFVLFVLAYIHIVFSRSPINCLEHVRDKWPREGILRVEVRHNSSRAPVFLQFCDSGGRGSFPGL     71 - 140
AVEPGSNLDMEDEEEEELTMEMFGNSSIKFELDIEPKVFKPPSSTEALNDSQEFPFPETPTKVWPQDEYI    141 - 210
VEYSLEYGFLRLSQATRQRLSIPVMVVTLDPTRDQCFGDRFSRLLLDEFLGYDDILMSSVKGLAENEENK    211 - 280
GFLRNVVSGEHYRFVSMWMARTSYLAAFAIMVIFTLSVSMLLRYSHHQIFVFIVDLLQMLEMNMAIAFPA    281 - 350
APLLTVILALVGMEAIMSEFFNDTTTAFYIILIVWLADQYDAICCHTSTSKRHWLRFFYLYHFAFYAYHY    351 - 420
RFNGQYSSLALVTSWLFIQHSMIYFFHHYELPAILQQVRIQEMLLQAPPLGPGTPTALPDDMNNNSGAPA    421 - 490
TAPDSAGQPPALGPVSPGASGSPGPVAAAPSSLVAAAASVAAAAGGDLGWMAETAAIITDASFLSGLSAS    491 - 560
LLERRPASPLGPAGGLPHAPQDSVPPSDSAASDTTPLGAAVGGPSPASMAPTEAPSEVGS              561 - 620
//

Text Mined References (10)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
16084606 2005 Identification and characterization of membralin, a novel tumor-associated gene, in ovarian carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12638133 2002 Characterization and expression of the gene encoding membralin, an evolutionary conserved protein expressed in the central nervous system.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.