Property Summary

NCBI Gene PubMed Count 24
Grant Count 9
R01 Count 4
Funding $1,049,751.82
PubMed Score 26.13
PubTator Score 27.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 4.100 0.000
glioblastoma -1.100 0.037
intraductal papillary-mucinous adenoma (... -1.100 0.002
intraductal papillary-mucinous neoplasm ... -1.100 0.023
lung cancer 2.900 0.000
breast carcinoma 1.400 0.001
pilocytic astrocytoma -1.300 0.003
lung carcinoma 2.300 0.000
ovarian cancer -2.600 0.002
pituitary cancer -1.100 0.026
psoriasis -1.100 0.000

Gene RIF (17)

PMID Text
25788566 the GREB1 region on chromosome 2p25.1 and the GREB1 gene may play a role in endometriosis risk
24998469 GREB1 is a critical mediator of both the estrogen-stimulated proliferation of breast cancer cells and the androgen-stimulated proliferation of prostate cancer cells
24469735 The expression of Greb1 was up-regulated in mouse tumors treated with E2 and was overexpressed in human ovarian cancers relative to human ovarian surface epithelium, suggesting a role for GREB1 in human ovarian tumor progression.
23876972 RAD54B and GREB1 gene polymorphisms may not be associated with PCOS in the Han Chinese population.
23403292 GREB1 is one of the central estrogen-specific ER cofactors, where it functions to mediate interactions between the ER and additional proteins.
22884659 GREB1 alpha mRNA/protein expression levels were increased in ectopic tissue in peritoneal endometriosis.
22359603 in ER-positive breast cancer cells, LRH-1 promotes cell proliferation by enhancing ERalpha mediated transcription of target genes such as GREB-1
21577013 Longer survival was associated with hypomethylation at specific CpG sites (e.g. GREB1, TGIF and TOB1) and hypermethylation in other genes (e.g. TMCO5, PTPRN and GUCY2C).
19945309 Tissue expression of GREB1 is associated with organ-confined prostate cancer and may constitute a gene associated with a favorable prognosis.
19842031 Characterize a monoclonal antibody that recognizes GREB1 protein in breast cancer cells.
More...

AA Sequence

MGNSYAGQLKTTRFEEVLHNSIEASLRSNNLVPRPIFSQLYLEAEQQLAALEGGSRVDNEEEEEEGEGGL      1 - 70
ETNGPPNPFQLHPLPEGCCTTDGFCQAGKDLRLVSISNEPMDVPAGFLLVGVKSPSLPDHLLVCAVDKRF     71 - 140
LPDDNGHNALLGFSGNCVGCGKKGFCYFTEFSNHINLKLTTQPKKQKHLKYYLVRNAQGTLTKGPLICWK    141 - 210
GSEFRSRQIPASTCSSSLFPALESTAAFPSEPVPGTNPSILMGAQQAGPASDHPSLNAAMGPAVFNGKDS    211 - 280
PKCQQLAKNNLLALPRPSALGILSNSGPPKKRHKGWSPESPSAPDGGCPQGGGNRAKYESAGMSCVPQVG    281 - 350
LVGPASVTFPVVASGEPVSVPDNLLKICKAKPVIFKGHGNFPYLCGNLNDVVVSPLLYTCYQNSQSVSRA    351 - 420
YEQYGASAIQPISEEMQLLLTVYYLVQLAADQVPLMEDLEQIFLRSWRESHLTEIRQYQQAPPQPFPPAP    421 - 490
SAAAPVTSAQLPWLASLAASSCNDSVHVIECAYSLAEGLSEMFRLLVEGKLAKTNYVVIICACRSAAIDS    491 - 560
CIAVTGKYQARILSESLLTPAEYQKEVNYELVTGKVDSLGAFFSTLCPEGDIDILLDKFHQENQGHISSS    561 - 630
LAASSVTKAASLDVSGTPVCTSYNLEPHSIRPFQLAVAQKLLSHVCSIADSSTQNLDLGSFEKVDFLICI    631 - 700
PPSEVTYQQTLLHVWHSGVLLELGLKKEHMTKQRVEQYVLKLDTEAQTKFKAFLQNSFQNPHTLFVLIHD    701 - 770
HAHWDLVSSTVHNLYSQSDPSVGLVDRLLNCREVKEAPNIVTLHVTSFPYALQTQHTLISPYNEIHWPAS    771 - 840
CSNGVDLYHENKKYFGLSEFIESTLSGHSLPLLRYDSSFEAMVTALGKRFPRLHSAVIRTFVLVQHYAAA    841 - 910
LMAVSGLPQMKNYTSVETLEITQNLLNSPKQCPCGHGLMVLLRVPCSPLAVVAYERLAHVRARLALEEHF    911 - 980
EIILGSPSSGVTVGKHFVKQLRMWQKIEDVEWRPQTYLELEGLPCILIFSGMDPHGESLPRSLRYCDLRL    981 - 1050
INSSCLVRTALEQELGLAAYFVSNEVPLEKGARNEALESDAEKLSSTDNEDEELGTEGSTSEKRSPMKRE   1051 - 1120
RSRSHDSASSSLSSKASGSALGGESSAQPTALPQGEHARSPQPRGPAEEGRAPGEKQRPRASQGPPSAIS   1121 - 1190
RHSPGPTPQPDCSLRTGQRSVQVSVTSSCSQLSSSSGSSSSSVAPAAGTWVLQASQCSLTKACRQPPIVF   1191 - 1260
LPKLVYDMVVSTDSSGLPKAASLLPSPSVMWASSFRPLLSKTMTSTEQSLYYRQWTVPRPSHMDYGNRAE   1261 - 1330
GRVDGFHPRRLLLSGPPQIGKTGAYLQFLSVLSRMLVRLTEVDVYDEEEININLREESDWHYLQLSDPWP   1331 - 1400
DLELFKKLPFDYIIHDPKYEDASLICSHYQGIKSEDRGMSRKPEDLYVRRQTARMRLSKYAAYNTYHHCE   1401 - 1470
QCHQYMGFHPRYQLYESTLHAFAFSYSMLGEEIQLHFIIPKSKEHHFVFSQPGGQLESMRLPLVTDKSHE   1471 - 1540
YIKSPTFTPTTGRHEHGLFNLYHAMDGASHLHVLVVKEYEMAIYKKYWPNHIMLVLPSIFNSAGVGAAHF   1541 - 1610
LIKELSYHNLELERNRQEELGIKPQDIWPFIVISDDSCVMWNVVDVNSAGERSREFSWSERNVSLKHIMQ   1611 - 1680
HIEAAPDIMHYALLGLRKWSSKTRASEVQEPFSRCHVHNFIILNVDLTQNVQYNQNRFLCDDVDFNLRVH   1681 - 1750
SAGLLLCRFNRFSVMKKQIVVGGHRSFHITSKVSDNSAAVVPAQYICAPDSKHTFLAAPAQLLLEKFLQH   1751 - 1820
HSHLFFPLSLKNHDHPVLSVDCYLNLGSQISVCYVSSRPHSLNISCSDLLFSGLLLYLCDSFVGASFLKK   1821 - 1890
FHFLKGATLCVICQDRSSLRQTVVRLELEDEWQFRLRDEFQTANAREDRPLFFLTGRHI              1891 - 1949
//

Text Mined References (27)

PMID Year Title
25788566 2015 Functional evaluation of genetic variants associated with endometriosis near GREB1.
24998469 2014 Consideration of GREB1 as a potential therapeutic target for hormone-responsive or endocrine-resistant cancers.
24469735 2014 17?-estradiol upregulates GREB1 and accelerates ovarian tumor progression in vivo.
23876972 2013 Replication study of RAD54B and GREB1 polymorphisms and risk of PCOS in Han Chinese.
23403292 2013 Endogenous purification reveals GREB1 as a key estrogen receptor regulatory factor.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23104006 2012 Genome-wide association meta-analysis identifies new endometriosis risk loci.
22884659 2012 The expression of estrogen receptors as well as GREB1, c-MYC, and cyclin D1, estrogen-regulated genes implicated in proliferation, is increased in peritoneal endometriosis.
22359603 2012 The orphan nuclear receptor LRH-1 and ER? activate GREB1 expression to induce breast cancer cell proliferation.
21577013 2011 Progression-free survival in ovarian cancer is reflected in epigenetic DNA methylation profiles.
More...