Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -3.300 4.2e-03
astrocytic glioma -3.300 1.3e-03
Astrocytoma, Pilocytic -3.700 7.0e-06
atypical teratoid / rhabdoid tumor -4.200 8.7e-07
cystic fibrosis 1.977 7.3e-05
ependymoma -3.800 9.5e-04
glioblastoma -3.000 1.6e-06
group 4 medulloblastoma -2.500 2.6e-02
medulloblastoma, large-cell -4.500 1.7e-03
oligodendroglioma -3.000 4.6e-03
Pick disease -1.700 3.5e-03
primitive neuroectodermal tumor -4.300 1.2e-04

AA Sequence

MASDLIRTILAVALISKLGTAVDAELMPSGAILQNKRENLPRVCHALAFLGMARCQDLFLVRLQGWKLGT      1 - 70
RFQDGPRSTPQEEGGSPQRKRGMPVQIHFLLKSFLSSPITFAFISLARTVSLATAICKIV               71 - 130
//

Text Mined References (5)

PMID Year Title