Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q4W5N1 Q9H7T1
Symbols ABCA11
EST1133530

Gene

 Compartment GO Term (0)

AA Sequence

MKYGNEIMNKDPVFRISPRSRGTHTNPEEPEEDVQAERVQAANALTTPNLEEEPVITASCLHKEYYETKK      1 - 70
VAFQQQRRKQPSEMFRFVLKSEVLGLLGHNGAGKSTSIKMITGCTVPTAGVVVLQGNRASVRQQRDNSLK     71 - 140
FLGTALRRTHCVPNLQ                                                          141 - 156
//

Text Mined References (4)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.