Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.25

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MLGKRKRVVLTIKDKLDIIKKLEEGISFKKLSVVYGIGESTVRDIKKNKERIINYANSSDPTSGVSKRKS      1 - 70
MKSSTYEELDRVMIEWFNQQKTDGIPVSGTICAKQAKFFFDALGMEGDFNASSGWLTRFKQRHGIPKAAG     71 - 140
KGTKLKGDETAAREFCGSFQEFVEKENLQPEQIYGADQTGLFWKCLPSRTLTLETDQSTSGCRSSRERII    141 - 210
IMCCANATGLHKLNLCVVGKAKKPRAFKGTDLSNLPVTYYSQKGAWIEQSVFRQWFEKYFVPQVQKHLKS    211 - 280
KGLLEKAVLLLDFPPARPNEEMLSSDDGRIIVKYLPPNVTSLIQPMSQGVLATVKRYYRAGLLQKYMDEG    281 - 350
NDPKIFWKNLTVLDAIYEVSRAWNMVKSSTITKAWKKLFPGNEENSGMNIDEGAILAANLATVLQNTEEC    351 - 420
EHVDIENIDQWFDSRSSDSSCQVLTDSESAEDQTKAAEQKPSSKSRKTELNPEKHISHKAALEWTENLLD    421 - 490
YLEQQDDMLLSDKLVLRRLRTIIRKKQKIQNNKNH                                       491 - 525
//

Text Mined References (6)

PMID Year Title
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
8917322 1996 Members of the pogo superfamily of DNA-mediated transposons in the human genome.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8643651 1996 Tiggers and DNA transposon fossils in the human genome.